Myxococcus stipitatus: MYSTI_05227 Help Entry MYSTI_05227       CDS       T02436                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism msd  Myxococcus stipitatus Pathway msd01100   Metabolic pathways msd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:msd00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     MYSTI_05227    00074 Mycolic acid biosynthesis     MYSTI_05227   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     MYSTI_05227 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C MAP Ribosomal_L12_N Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  AGC46508 UniProt:  L7UEP4 LinkDB All DBs Position complement(6709036..6709284) Genome browser AA seq 82 aa AA seqDB search MSTNIEAKVKSIIADQLGVSDEEIKPEASFIEDLGADSLDIVELVMAMEEEFEVEIPDEE AENIKTVGDAVNYIKTHKPQAE NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgtcgacgaacattgaagccaaggtcaagagcatcatcgcggatcagctcggcgtgagc gatgaagagatcaagcccgaggcttccttcatcgaggaccttggcgccgacagcctcgac atcgtggagctcgtgatggcgatggaagaggagttcgaggtcgagattcccgacgaggag gccgagaacatcaagaccgttggcgacgccgtcaactacatcaagacccacaagccccaa gctgagtag

DBGET integrated database retrieval system