Myxococcus stipitatus: MYSTI_05385 Help Entry MYSTI_05385       CDS       T02436                                  Name (GenBank) GrxC family glutaredoxin   KO K03676   glutaredoxin 3 Organism msd  Myxococcus stipitatus Brite KEGG Orthology (KO) [BR:msd00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:msd03110]     MYSTI_05385 Chaperones and folding catalysts [BR:msd03110]  Protein folding catalysts   Protein disulfide isomerase    MYSTI_05385 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin Glrx-like SH3BGR GST_N_2 GST_N_3 Motif Other DBs NCBI-ProteinID:  AGC46664 UniProt:  L7UJP1 LinkDB All DBs Position 6973111..6973368 Genome browser AA seq 85 aa AA seqDB search MKPVKIYTTNYCGFCVRAKDLLKRKGVDFQELDVTGDDDTRAKLVEMSGGQRTVPQIFIG DTHVGGYSDLAQLDKDGKLDTLLQA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt gtgaagcccgtgaagatctacaccacgaactactgtggtttctgtgtccgcgcgaaggac ctgctcaagcgaaagggcgtggacttccaggagctggacgtcactggagacgacgacacc cgagcgaagctcgtggagatgagcggaggccagcgcacggtgccgcaaatcttcatcggc gacacgcacgtgggcggctactcggacctcgcccagctcgacaaggacggcaagctggac accctgctccaggcctga

DBGET integrated database retrieval system