Metallosphaera sedula DSM 5348: Msed_0203 Help Entry Msed_0203         CDS       T00509                                  Name (GenBank) LSU ribosomal protein L40E   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism mse  Metallosphaera sedula DSM 5348 Pathway mse03010   Ribosome Brite KEGG Orthology (KO) [BR:mse00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     Msed_0203   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     Msed_0203  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:mse03011]     Msed_0203    04121 Ubiquitin system [BR:mse04121]     Msed_0203 Ribosome [BR:mse03011]  Ribosomal proteins   Eukaryotes    Large subunit     Msed_0203   Archaea     Msed_0203 Ubiquitin system [BR:mse04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    Msed_0203 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_L40e zf-ChsH2 HypA Zn_ribbon_3 DZR HVO_2753_ZBP Zn_Ribbon_1 DnaJ_CXXCXGXG Zn_ribbon_HMPTM DUF7577 Zn_ribbon_tTFIIB Zn_ribbon_LapB Zn_ribbon_13 Zn_ribbon_8 Motif Other DBs NCBI-ProteinID:  ABP94380 UniProt:  A4YD78 LinkDB All DBs Position complement(167055..167225) Genome browser AA seq 56 aa AA seqDB search MPLTDQAKIQIVQERVFIKKVCRNCGALNSIRATKCRRCHSTNLRPKKKELPTKRA NT seq 171 nt NT seq  +upstreamnt  +downstreamnt atgcctttaacagatcaggcaaaaattcagatagtccaagagagagtgtttataaagaag gtgtgcagaaactgcggtgcccttaactcgatcagggctacaaaatgcagaagatgtcat agtacaaatctcagaccaaagaagaaggagttgccaactaagagagcttga

DBGET integrated database retrieval system