KEGG   Metallosphaera sedula DSM 5348: Msed_1684
Entry
Msed_1684         CDS       T00509                                 
Name
(GenBank) L-aspartate aminotransferase apoenzyme
  KO
K00812  aspartate aminotransferase [EC:2.6.1.1]
Organism
mse  Metallosphaera sedula DSM 5348
Pathway
mse00220  Arginine biosynthesis
mse00250  Alanine, aspartate and glutamate metabolism
mse00270  Cysteine and methionine metabolism
mse00330  Arginine and proline metabolism
mse00350  Tyrosine metabolism
mse00360  Phenylalanine metabolism
mse00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mse00401  Novobiocin biosynthesis
mse01100  Metabolic pathways
mse01110  Biosynthesis of secondary metabolites
mse01210  2-Oxocarboxylic acid metabolism
mse01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mse00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Msed_1684
   00270 Cysteine and methionine metabolism
    Msed_1684
   00220 Arginine biosynthesis
    Msed_1684
   00330 Arginine and proline metabolism
    Msed_1684
   00350 Tyrosine metabolism
    Msed_1684
   00360 Phenylalanine metabolism
    Msed_1684
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Msed_1684
  09110 Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    Msed_1684
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mse01007]
    Msed_1684
Enzymes [BR:mse01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     Msed_1684
Amino acid related enzymes [BR:mse01007]
 Aminotransferase (transaminase)
  Class I
   Msed_1684
SSDB
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Cys_Met_Meta_PP
Other DBs
NCBI-ProteinID: ABP95839
UniProt: A4YHD7
LinkDB
Position
complement(1623126..1624316)
AA seq 396 aa
MENFAGSLSRLTGESTLLYQEIARNVERTKGIKTINFGIGQPDLPTPQRIREEAKLALDK
GFTAYTPALGLDELRSKIAEFLTQRYGDQIRKEEVAVTPGAKTALFLAFLMYVNPGDEVI
LFDPSFYSYAEVVNLLGGKPVYVPLSFDENSGFSVDMDELVSKITPRTKMIVYNNPHNPT
GMNFNDKLARELVEIAREKRLILLSDEIYDYFVYDGGFRSVLQEAWRDNVIYINGFSKTF
SMTGWRLGYIVAKREVINKVGILASNIYTCPTSFAQRGALASFDTFDEVRRMIDLFKRRR
DVMFSELKSLKGIRVYKSSGAFYMFPDVSEILKTTGMDSKALAVKIIEEGGVVTIPGEVF
PEKVGRNFLRLSFALDEEKIKEGVSRMKMALEKLTG
NT seq 1191 nt   +upstreamnt  +downstreamnt
atggaaaatttcgctggttcgctttcaagattaactggagagtcaaccctcctttatcag
gaaatagccagaaacgtggagaggaccaagggaataaagaccatcaacttcggcataggc
caacctgatctaccaactcctcagagaataagggaagaggctaaactggcactggataag
ggtttcaccgcatacaccccagcactggggttagacgagttaagatccaagatagcggaa
tttcttacccagagatacggggatcaaataaggaaggaagaggtagctgttacgcctggg
gctaagactgcactcttcctggcatttctcatgtatgttaaccctggcgatgaggtaatc
ctattcgatccttccttctactcctatgcagaagtggttaacctcctagggggaaaacca
gtttatgtccctctcagctttgacgagaactcgggtttcagtgtcgacatggatgagtta
gtttccaagatcactcccagaaccaagatgatagtttataataaccctcataacccgact
ggaatgaacttcaacgataaacttgcgagggaactagttgagatagctagggagaagagg
ttaatccttctttcagacgaaatttacgactacttcgtctatgacggcggtttcaggagc
gtgcttcaggaagcgtggagagataacgtgatttacataaacgggttcagcaagaccttc
agcatgacaggttggagactgggatatattgttgccaaaagggaggtcattaacaaggtt
ggcatattagcgtccaatatatacacatgtcccactagctttgcccaaaggggtgcatta
gcctcctttgataccttcgacgaggtgagacgcatgatagacctgtttaagagaaggaga
gacgttatgttctcggagcttaagtccctcaagggaattagggtttacaagtcgtctggg
gcattctacatgtttccagacgttagcgaaatcctgaagacgactggaatggattcaaag
gccttagcggtgaaaataattgaggaggggggtgtggtaactatcccaggtgaggtgttt
ccagaaaaggttgggagaaacttcctgagattgagctttgccctagatgaggagaaaatt
aaagagggcgtgtcaaggatgaaaatggcactggagaaactcacaggttga

DBGET integrated database retrieval system