Mesoterricola sediminis: METESE_02350 Help Entry METESE_02350      CDS       T09356                                  Name (GenBank) hypothetical protein   KO K03073   preprotein translocase subunit SecE Organism msea  Mesoterricola sediminis Pathway msea02024   Quorum sensing msea03060   Protein export msea03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:msea00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     METESE_02350  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     METESE_02350  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     METESE_02350  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:msea02044]     METESE_02350 Secretion system [BR:msea02044]  Sec (secretion) system   Prokaryotic Sec-SRP core components    METESE_02350 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SecE Motif Other DBs NCBI-ProteinID:  BDU75277 UniProt:  A0AA48KCE8 LinkDB All DBs Position 277335..277526 Genome browser AA seq 63 aa AA seqDB search MISTIKHQAKELLSELKRVDWPGKQKVLSAATSVAIVSTFVGLFLWAADKAISWGMTFIL PQH NT seq 192 nt NT seq  +upstreamnt  +downstreamnt ttgatttcaaccatcaagcatcaagccaaggagctcctcagcgagctcaagcgcgtggat tggccgggcaagcagaaggtcctcagcgcggccacctcggtggccattgtgtcgacgttc gtcggtctgttcctttgggcggcggacaaggcgatctcctgggggatgaccttcatcctc ccccaacactag

DBGET integrated database retrieval system