Mesoterricola sediminis: METESE_06430 Help Entry METESE_06430      CDS       T09356                                  Symbol acpP_1 Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism msea  Mesoterricola sediminis Pathway msea01100   Metabolic pathways msea01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:msea00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     METESE_06430 (acpP_1)    00074 Mycolic acid biosynthesis     METESE_06430 (acpP_1)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     METESE_06430 (acpP_1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding OPA1_C MID51-like_C Motif Other DBs NCBI-ProteinID:  BDU75685 UniProt:  A0AA48GU43 LinkDB All DBs Position complement(780009..780263) Genome browser AA seq 84 aa AA seqDB search MTLTHEEILARLQAILHASFDLPVEKVTLDAHLFTDLDLDSIDAVELAIQLQELTGRRVK AEEFKHVRTVRDVVEAVHQMLSAS NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgaccctcacccacgaagaaatcctcgcccgccttcaggccattctgcatgcgtccttc gacctgcccgtggagaaggtgaccctggacgcccacctgttcacggacctggacctggac agcatcgacgccgtggagctggccatccagctccaggagctcacgggccggcgggtgaag gccgaggagttcaagcacgtgcgcacggtccgggacgtggtggaggccgtccaccagatg ctctccgcctcatga

DBGET integrated database retrieval system