Mesoterricola sediminis: METESE_25320 Help Entry METESE_25320      CDS       T09356                                  Name (GenBank) hypothetical protein   KO K03116   sec-independent protein translocase protein TatA Organism msea  Mesoterricola sediminis Pathway msea03060   Protein export msea03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:msea00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     METESE_25320  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     METESE_25320  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:msea02044]     METESE_25320 Secretion system [BR:msea02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    METESE_25320 SSDB OrthologParalogGFIT Motif Pfam:  TatA_B_E Motif Other DBs NCBI-ProteinID:  BDU77574 UniProt:  A0AA48GTR1 LinkDB All DBs Position complement(2956071..2956232) Genome browser AA seq 53 aa AA seqDB search MGNLGLTEILLIGVALLIFFGPSKLPELGKSLGRGIQEFKKASKEITAPLKGE NT seq 162 nt NT seq  +upstreamnt  +downstreamnt atgggaaacctgggattgaccgagatcctcctgatcggcgtcgcgctgctgatcttcttc ggaccctccaagctgcccgaactgggcaagtcgctgggcaggggcatccaggagttcaag aaggccagcaaggaaatcaccgcccccctcaagggcgaatga

DBGET integrated database retrieval system