Marinobacterium sediminicola: LN244_11615 Help Entry LN244_11615       CDS       T07998                                  Name (GenBank) MmoB/DmpM family protein   KO K16244   phenol/toluene 2-monooxygenase (NADH) P2/A2 [EC:1.14.13.244 1.14.13.243] Organism msec  Marinobacterium sediminicola Pathway msec00361   Chlorocyclohexane and chlorobenzene degradation msec00362   Benzoate degradation msec00623   Toluene degradation msec01100   Metabolic pathways msec01120   Microbial metabolism in diverse environments msec01220   Degradation of aromatic compounds Module msec_M00548   Benzene degradation, benzene => catechol Brite KEGG Orthology (KO) [BR:msec00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     LN244_11615    00361 Chlorocyclohexane and chlorobenzene degradation     LN244_11615    00623 Toluene degradation     LN244_11615 Enzymes [BR:msec01000]  1. Oxidoreductases   1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen    1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor     1.14.13.243  toluene 2-monooxygenase      LN244_11615     1.14.13.244  phenol 2-monooxygenase (NADH)      LN244_11615 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MmoB_DmpM Motif Other DBs NCBI-ProteinID:  ULG68348 LinkDB All DBs Position complement(2564103..2564372) Genome browser AA seq 89 aa AA seqDB search MSKVYIALQDNDESRYIVEAIEEDNSEATVIHMPAMIRIEAENFLAVKRETVEEKMGRDW DVQELHVNLITLGGNVDEDDDQLTLTWNE NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgtccaaagtttatatcgcactgcaggataacgacgagtcccgttacatcgttgaggcg attgaggaagacaactccgaggcgaccgtgatccacatgccggccatgatccgcatcgag gcggaaaacttcctcgcggtgaagcgtgaaaccgttgaagagaagatggggcgcgactgg gacgtacaagaactgcacgtcaacctgatcaccctcggtggcaacgtggatgaagacgat gatcagctgacgctgacctggaacgaataa

DBGET integrated database retrieval system