KEGG   Metabacillus sediminilitoris: GMB29_04845
Entry
GMB29_04845       CDS       T07731                                 
Name
(GenBank) BMP family ABC transporter substrate-binding protein
  KO
K05519  transcriptional activator of comK gene
Organism
msem  Metabacillus sediminilitoris
Brite
KEGG Orthology (KO) [BR:msem00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:msem03000]
    GMB29_04845
Transcription factors [BR:msem03000]
 Prokaryotic type
  Other transcription factors
   Others
    GMB29_04845
SSDB
Motif
Pfam: Bmp Peripla_BP_4
Other DBs
NCBI-ProteinID: QGQ44652
LinkDB
Position
951796..952749
AA seq 317 aa
MYKKLGLILILLFSLYGCGQPTTTGNLQKVGLLVQETIDEKVWGMKGYEGLLKIQSDLGV
DVFYKEGMNEDIKIRHAIEEFQQNDVNLIFGHGSEFAGSFQAISKDYPDIHFVLFNSDVS
GRNITSLNFESHAMGFFGGMVAGEMTNTKKIGVLAAFEWQPEIDGFFEGAYFQNENVHVN
IKYVQDWNNTADALPLLEEMIDDNVDIVYVAGDGYNIPVIERLKEEGLYAIGYVNDQADL
GNRTVLTSTVQHIDELYVNVAKSFNKGELENGEVYFDFKDGVISMGEFSPLVDQEFQSNL
NEHIEEYKKSGLLPNQL
NT seq 954 nt   +upstreamnt  +downstreamnt
atgtacaaaaagctcggacttatcctcatattacttttttcgctttatggttgtggacaa
cctacaacaactggcaatcttcaaaaggtcggtttacttgttcaggaaacaattgatgaa
aaagtttggggtatgaaaggctatgaagggctattaaaaattcaatcagatctaggtgta
gatgtattttataaagaaggtatgaacgaagacattaagattcgtcatgcaattgaggaa
tttcaacaaaatgatgtaaatcttatttttggtcatggcagcgaatttgcaggttcattt
caagcgattagtaaagattatccggatattcattttgttttatttaattctgatgtatca
ggtagaaatataacaagtcttaatttcgaatcacatgcaatgggcttttttggcgggatg
gttgcaggtgaaatgacaaatacaaaaaaaataggcgtgttagctgctttcgagtggcag
ccggaaattgatggcttttttgaaggtgcatattttcaaaatgaaaatgttcatgtcaat
attaagtatgtgcaagattggaataacacagcagatgcattgccgcttttagaagaaatg
atcgatgacaatgtcgacattgtgtacgttgcaggggacgggtataatataccagtgatc
gagcgcctaaaagaagaaggtttatatgcgatcggatatgtcaatgatcaggctgattta
ggcaatagaactgtgttaacaagtactgtccagcatattgacgaattatatgtaaatgtg
gcaaaatcctttaataaaggcgagttagaaaatggtgaggtttatttcgacttcaaagac
ggtgtcatctcgatgggagagttcagtcctcttgttgatcaagaatttcaatcaaacctg
aatgaacacattgaagaatataaaaaaagtggactacttccaaatcagttataa

DBGET integrated database retrieval system