Manduca sexta (tobacco hornworm): 115441837 Help Entry 115441837         CDS       T07401                                  Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism msex  Manduca sexta (tobacco hornworm) Pathway msex04137   Mitophagy - animal msex04140   Autophagy - animal msex04144   Endocytosis msex04145   Phagosome msex04148   Efferocytosis Brite KEGG Orthology (KO) [BR:msex00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     115441837    04145 Phagosome     115441837    04140 Autophagy - animal     115441837    04137 Mitophagy - animal     115441837    04148 Efferocytosis     115441837  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:msex04131]     115441837   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:msex04147]     115441837    04031 GTP-binding proteins [BR:msex04031]     115441837 Membrane trafficking [BR:msex04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     115441837 Exosome [BR:msex04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    115441837   Exosomal proteins of other body fluids (saliva and urine)    115441837   Exosomal proteins of colorectal cancer cells    115441837   Exosomal proteins of bladder cancer cells    115441837 GTP-binding proteins [BR:msex04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     115441837 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase ATP_bind_1 nSTAND3 cobW Septin AAA_16 AAA_24 PduV-EutP AAA_22 NACHT AAA_7 AAA_5 ATPase_2 G-alpha NTPase_1 SRPRB ABC_tran AAA_14 ATP-synt_ab NB-ARC TniB RNA_helicase PRK DAP3 Motif Other DBs NCBI-GeneID:  115441837 NCBI-ProteinID:  XP_030022611 LinkDB All DBs Position 28:6759824..6761954 Genome browser AA seq 208 aa AA seqDB search MSSRKKVLLKVIILGDSGVGKTSLMNQFVNKKFSNQYKATIGADFLTKEVIVDDRIVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKSLESWRDEFLIQASPRDPDNFPF VILGNKVDLDNRAVSAKRAQQWCQSKNDIPYFETSAKEAVNVELAFQTIARNALAQETEA ELYNEFPDQIKLNANDNGRNRDGDNCAC NT seq 627 nt NT seq  +upstreamnt  +downstreamnt atgtcttcaagaaaaaaggtactcctgaaggtaatcatcttgggagatagcggtgtcgga aaaacatcactcatgaatcagtttgtcaacaagaaattttccaatcagtacaaggcaaca ataggcgcagattttctcacgaaagaggtaatcgttgacgacaggatcgtcacaatgcag atttgggacacagccggccaagagcgtttccagtcgttgggagtagcattttatcgcggg gcggattgttgcgtattagtgtttgacgtaactgcccccaacacgtttaagtccttggaa agctggagagacgaattcctgatacaagcttcgccgagagaccctgacaacttcccgttc gtgatattaggcaataaggtcgacttggataaccgcgccgtttccgcaaagcgtgctcaa cagtggtgtcaaagcaagaatgatattccgtactttgaaacgagtgccaaagaagccgtg aacgtagaactagcctttcagactatagctcgcaatgccctggcgcaggaaaccgaagca gagttgtacaatgagttccctgaccaaatcaagttaaatgccaacgacaatgggcgcaac agggatggcgacaattgtgcttgctag

DBGET integrated database retrieval system