Manduca sexta (tobacco hornworm): 115442586 Help Entry 115442586         CDS       T07401                                  Name (RefSeq) dynein light chain 4, axonemal   KO K10412   dynein axonemal light chain 4 Organism msex  Manduca sexta (tobacco hornworm) Pathway msex04814   Motor proteins Brite KEGG Orthology (KO) [BR:msex00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     115442586  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:msex03037]     115442586    04812 Cytoskeleton proteins [BR:msex04812]     115442586 Cilium and associated proteins [BR:msex03037]  Motile cilia and associated proteins   Dynein arm    115442586 Cytoskeleton proteins [BR:msex04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      115442586 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Dynein_light Motif Other DBs NCBI-GeneID:  115442586 NCBI-ProteinID:  XP_030023522 LinkDB All DBs Position 17:13683977..13689651 Genome browser AA seq 107 aa AA seqDB search MAEEGAAAAPGGATEKVVHTYPLIRHSDMSEEMRTEAMELSVTACEKFAQNNELAARMVK ESMDKKFGPAFHVVVGESYGFEITYECTTICYMYFGGNQAVCIWKCS NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atggcggaagaaggagcagcagcggcccctggaggggctactgagaaagttgttcacacc taccctcttatacgacactcagacatgtcagaagagatgcggacggaggcaatggagttg tctgtgacggcttgcgagaaatttgctcagaacaacgagttagcagcgcgcatggtgaag gagtctatggataagaagttcggacccgccttccacgtggtggtgggagagagctacggc ttcgagatcacttacgagtgtaccacaatatgctacatgtattttggcgggaaccaggct gtttgcatatggaaatgttcgtga

DBGET integrated database retrieval system