Manduca sexta (tobacco hornworm): 115442786 Help Entry 115442786         CDS       T07401                                  Name (RefSeq) ras-related protein Rac1   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism msex  Manduca sexta (tobacco hornworm) Pathway msex04013   MAPK signaling pathway - fly msex04145   Phagosome msex04148   Efferocytosis msex04310   Wnt signaling pathway msex04620   Toll-like receptor signaling pathway msex05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:msex00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     115442786    04310 Wnt signaling pathway     115442786  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     115442786    04148 Efferocytosis     115442786  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     115442786  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     115442786  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:msex04131]     115442786   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:msex04147]     115442786    04031 GTP-binding proteins [BR:msex04031]     115442786 Membrane trafficking [BR:msex04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     115442786  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     115442786   Macropinocytosis    Ras GTPases     115442786  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     115442786 Exosome [BR:msex04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    115442786   Exosomal proteins of other body fluids (saliva and urine)    115442786   Exosomal proteins of colorectal cancer cells    115442786   Exosomal proteins of bladder cancer cells    115442786 GTP-binding proteins [BR:msex04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     115442786 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU CagD Motif Other DBs NCBI-GeneID:  115442786 NCBI-ProteinID:  XP_030023801 LinkDB All DBs Position 12:complement(4027284..4074381) Genome browser AA seq 192 aa AA seqDB search MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPINLGLWDTAG QEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPSTPIILVGTKLDLR EDKDTIEKLKDKKLAPITYTQGLGMSKEINAVKYLECSALTQKGLKTVFDEAIRAVLCPV PPPKQSRKCTLL NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atgcaggcgatcaagtgtgtcgtcgtcggagacggtgccgtcggtaaaacatgtctgctc atcagctacacgacaaatgccttccccggagaatacatacctacagtattcgacaattat tcagcgaatgtgatggtggacgggaagccgatcaacctgggcctgtgggatacggcgggg caggaggactacgaccggctgcggccgctgtcctacccacagaccgacgtgttccttata tgcttctcgctcgtcaacccggcttcgttcgagaacgttcgggctaagtggtacccagaa gtgcggcatcactgcccgtcgacgcccatcatcctcgtcggtaccaagctggacttgcgc gaagacaaagacaccatagagaaacttaaggacaagaagctcgcgcctatcacttacaca cagggtctgggcatgtcgaaggagatcaacgcggtgaagtacctcgagtgctctgcgctg acgcagaagggtctgaagacggtgttcgacgaggccatccgcgccgtgctgtgtcccgtg ccgccccccaaacagagccggaagtgcacgctgctgtaa

DBGET integrated database retrieval system