Manduca sexta (tobacco hornworm): 115447818 Help Entry 115447818         CDS       T07401                                  Name (RefSeq) bombyxin-related peptide A-like   KO K04526   insulin Organism msex  Manduca sexta (tobacco hornworm) Pathway msex04068   FoxO signaling pathway msex04081   Hormone signaling msex04140   Autophagy - animal msex04150   mTOR signaling pathway msex04213   Longevity regulating pathway - multiple species Brite KEGG Orthology (KO) [BR:msex00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     115447818    04150 mTOR signaling pathway     115447818   09133 Signaling molecules and interaction    04081 Hormone signaling     115447818  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     115447818  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     115447818  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:msex04052]     115447818 Cytokines and neuropeptides [BR:msex04052]  Neuropeptides   Unclassified    115447818 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Ins_beta Motif Other DBs NCBI-GeneID:  115447818 NCBI-ProteinID:  XP_030030916 LinkDB All DBs Position 15:complement(963830..964114) Genome browser AA seq 94 aa AA seqDB search MKLAVVLCCLFVLCSLAEVQGAQRFCGRRLARTLAGLCSEVEYEDVVKRSGDGDPADGTR GWRWAALGGARGKRGVVEECCERACTLDELITYC NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atgaagctcgctgttgtgttgtgttgcttgttcgtgctgtgctcgctggctgaagtccaa ggagcgcagaggttttgtgggcgacggctggcccggactttggcggggctctgctccgag gtggagtatgaagacgtggtgaagaggtctggtgatggcgaccctgcggatggtactcgc ggctggcgctgggcggcgctgggaggtgcgcgcggcaagagaggagtcgtcgaggagtgc tgcgagagggcctgtacgctcgatgagctgatcacatactgctga

DBGET integrated database retrieval system