Manduca sexta (tobacco hornworm): 115451565 Help Entry 115451565         CDS       T07401                                  Name (RefSeq) elongin-B   KO K03873   elongin-B Organism msex  Manduca sexta (tobacco hornworm) Pathway msex04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:msex00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     115451565  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:msex04121]     115451565    03400 DNA repair and recombination proteins [BR:msex03400]     115451565 Ubiquitin system [BR:msex04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      115451565    Cul5 complex      115451565 DNA repair and recombination proteins [BR:msex03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      115451565 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Ubiquitin_2 Motif Other DBs NCBI-GeneID:  115451565 NCBI-ProteinID:  XP_030035775 LinkDB All DBs Position 21:13350194..13358384 Genome browser AA seq 119 aa AA seqDB search MDVFLMIRRKKLTIFTDAKDATTVLELKKMIEGILKVPPASQMLFNKDSQLMEDEKTLAE YGLTSNVAKAQCPAPIGLALRKENGEFEALDLTPYSSPPDLPDVMKSQETNGQEQMDQH NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggatgtctttttaatgattaggcgaaaaaagttaaccatcttcacagacgcaaaggat gctacgactgtactagaattgaagaaaatgatcgaaggcatcctgaaggtgcctcctgcc agccagatgctgttcaacaaagacagccagctaatggaggatgagaagaccctggctgag tatggactgacatctaacgttgctaaggcacagtgccccgcgcccattggacttgctctc aggaaggagaatggtgaattcgaggcattggatctgactccttactcttcgcccccggat ctgccagacgtcatgaagtcacaggaaaccaacggacaggaacagatggaccagcactaa

DBGET integrated database retrieval system