Mycolicibacterium smegmatis MC2 155: MSMEI_5383 Help Entry MSMEI_5383        CDS       T02191                                  Name (GenBank) Chorismate mutase   KO K04093   chorismate mutase [EC:5.4.99.5] Organism msg  Mycolicibacterium smegmatis MC2 155 Pathway msg00400   Phenylalanine, tyrosine and tryptophan biosynthesis msg01100   Metabolic pathways msg01110   Biosynthesis of secondary metabolites msg01230   Biosynthesis of amino acids Brite KEGG Orthology (KO) [BR:msg00001]  09100 Metabolism   09105 Amino acid metabolism    00400 Phenylalanine, tyrosine and tryptophan biosynthesis     MSMEI_5383 Enzymes [BR:msg01000]  5. Isomerases   5.4  Intramolecular transferases    5.4.99  Transferring other groups     5.4.99.5  chorismate mutase      MSMEI_5383 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CM_2 Motif Other DBs NCBI-ProteinID:  AFP41824 UniProt:  A0R3N5 LinkDB All DBs Position 5626972..5627268 Genome browser AA seq 98 aa AA seqDB search MGPPHDEEPHMPETIDAVPEIDDLRREIDELDATIIAAIQRRTEVSKTIGKARMASGGTR LVHSREMKVIERYIDALGPEGKDLAMLLLRLGRGRLGY NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgggacccccacacgatgaggagcctcacatgcctgagaccatcgatgccgtgcctgag atcgatgacctgcgtcgtgagatcgacgaactcgacgccaccatcatcgccgccatccag cggcgcaccgaagtgtcgaagaccatcggtaaagcacgcatggcatcgggcggtacccgc ctggtccacagccgtgagatgaaggtcatcgagcgctacatcgacgcgctcggcccggag ggcaaggacctcgcgatgctgttgctgcgcctcggccgcggccgcctcgggtactag

DBGET integrated database retrieval system