Marinobacter shengliensis: MAALD49_03760 Help Entry MAALD49_03760     CDS       T09258                                  Symbol mphK Name (GenBank) phenol 2-monooxygenase   KO K16249   phenol/toluene 2-monooxygenase (NADH) P0/A0 Organism mshe  Marinobacter shengliensis Pathway mshe00361   Chlorocyclohexane and chlorobenzene degradation mshe00362   Benzoate degradation mshe00623   Toluene degradation mshe01100   Metabolic pathways mshe01120   Microbial metabolism in diverse environments mshe01220   Degradation of aromatic compounds Module mshe_M00548   Benzene degradation, benzene => catechol Brite KEGG Orthology (KO) [BR:mshe00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     MAALD49_03760 (mphK)    00361 Chlorocyclohexane and chlorobenzene degradation     MAALD49_03760 (mphK)    00623 Toluene degradation     MAALD49_03760 (mphK) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Phenol_hyd_sub Motif Other DBs NCBI-ProteinID:  BEH13008 LinkDB All DBs Position 434703..434963 Genome browser AA seq 86 aa AA seqDB search MTNQPEAKTFNEMTRYIRVRSEPGDKFVEFDFAIGYPELFVELVLPREAFEIFCKHNNVV HMDSDMIREIDEDMIKWRFGERGQRY NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgacgaaccaaccagaagccaagactttcaacgaaatgacccgctatatccgggttcgc agcgagccaggtgacaaattcgtggaattcgattttgccattggttatccggagctgttc gtcgagcttgtgctgccaagggaagccttcgagattttctgcaagcacaacaacgtggtc catatggattcggacatgatccgtgagatcgacgaagacatgatcaagtggcgcttcggc gagcgcggtcagcgttactga

DBGET integrated database retrieval system