Marinobacter shengliensis: MAALD49_35070 Help Entry MAALD49_35070     CDS       T09258                                  Name (GenBank) hypothetical protein   KO K24111   aryl carrier protein AsbD Organism mshe  Marinobacter shengliensis Pathway mshe00975   Biosynthesis of various siderophores mshe01100   Metabolic pathways mshe01110   Biosynthesis of secondary metabolites Module mshe_M01060   Petrobactin biosynthesis, spermidine => petrobactin Brite KEGG Orthology (KO) [BR:mshe00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00975 Biosynthesis of various siderophores     MAALD49_35070  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:mshe01008]     MAALD49_35070 Polyketide biosynthesis proteins [BR:mshe01008]  Nonribosomal peptide synthetase (NRPS)   Nonlinear NRPS    Petrobacin synthetase     MAALD49_35070 SSDB OrthologParalogGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  BEH16139 LinkDB All DBs Position 3844368..3844637 Genome browser AA seq 89 aa AA seqDB search MSKTNLTRSAIETVIRNHLPDARLSVFSAKARLNADLAIDSIMLLQLIVHLELEHGLHVP EEALLTHQLETVEDLEALLVATGNPEVSL NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgagcaaaaccaacctgacccgaagcgccattgaaacggtgattcgaaaccatctacct gacgcccggctatcggtgttttcggccaaggcccgcctcaacgccgacctggcgattgat tccatcatgctgctgcaactgattgtgcacctggaacttgagcacggcctgcatgttccg gaggaagcgctgctgacccatcagctcgagaccgttgaggatctggaagcgctattggtc gccaccggcaatccggaggtttccctgtga

DBGET integrated database retrieval system