Mycobacterium shottsii: MSHO_59400 Help Entry MSHO_59400        CDS       T07303                                  Name (GenBank) NrdH-redoxin   KO K18917   mycoredoxin [EC:1.20.4.3] Organism msho  Mycobacterium shottsii Brite KEGG Orthology (KO) [BR:msho00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     MSHO_59400 Enzymes [BR:msho01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      MSHO_59400 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_2 Thioredoxin_2 Glrx-like Thioredoxin Motif Other DBs NCBI-ProteinID:  BBX60595 UniProt:  A0A7I7LL73 LinkDB All DBs Position 5734287..5734541 Genome browser AA seq 84 aa AA seqDB search MTNAALTIYTTSWCGYCLRLKTALKAEGIAYDEIDIEREPAAGDFVGSVNGGNRTVPTVK FADGSTLTNPSAREVKKKMADIGG NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgaccaatgctgcgctcaccatctacacaacttcatggtgtggttattgtcttcggctc aagacggccctaaaagccgaaggaatcgcctacgatgagatcgacattgaacgcgaacct gccgcaggggatttcgtaggctcggtcaacgggggcaaccggaccgttccgacagtgaag ttcgcagacggctcgacgctgaccaaccccagcgcccgggaggtcaagaaaaaaatggcc gacattggcggctag

DBGET integrated database retrieval system