Mesoterricola silvestris: METEAL_06290 Help Entry METEAL_06290      CDS       T09355                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism msil  Mesoterricola silvestris Pathway msil00998   Biosynthesis of various antibiotics msil01100   Metabolic pathways msil01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:msil00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     METEAL_06290    00074 Mycolic acid biosynthesis     METEAL_06290   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     METEAL_06290 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF1493 Motif Other DBs NCBI-ProteinID:  BDU71455 UniProt:  A0AA48GL46 LinkDB All DBs Position complement(771486..771740) Genome browser AA seq 84 aa AA seqDB search MPPKTQDEILQWVRAALKTNFQLDPRSVHLDSNLFTDLGLDSIDEVELAQHMQEFTGRRL APDDFRVLCTVEDVVLSVQKMLEA NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgccgcctaagacccaggacgagattctccagtgggtccgcgccgccctgaagaccaat ttccagctggatccgcgctccgtgcacctggattccaacctcttcaccgacctgggcctg gacagcatcgacgaagtcgaactggcccaacacatgcaagaattcacggggcggcgcctg gcccccgacgacttccgggtgctctgcaccgtggaggacgtggtgctctccgtgcagaag atgctggaggcctga

DBGET integrated database retrieval system