Mesoterricola silvestris: METEAL_39950 Help Entry METEAL_39950      CDS       T09355                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism msil  Mesoterricola silvestris Pathway msil00998   Biosynthesis of various antibiotics msil01100   Metabolic pathways msil01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:msil00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     METEAL_39950    00074 Mycolic acid biosynthesis     METEAL_39950   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     METEAL_39950 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  BDU74821 UniProt:  A0AA48GZQ1 LinkDB All DBs Position 4732699..4732920 Genome browser AA seq 73 aa AA seqDB search MDVFYQKLREILECEDVRRDSDIGDFENWDSLGVLTILAMIDSEYKVALSSEEFLTVRRV GDLEDLLRAKLGR NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atggacgttttctaccagaagctccgagagatcctggaatgcgaggacgtccgccgggat tccgatatcggcgatttcgagaactgggattccctgggggtcctcaccatcctggcaatg atcgattccgagtacaaggtcgccctgtcctccgaggaattcctcacggtgcgcagggtc ggggacctcgaggacctgctccgggcgaagctgggcaggtga

DBGET integrated database retrieval system