Mycobacterium simiae: MSIM_12080 Help Entry MSIM_12080        CDS       T07396                                  Name (GenBank) NrdH-redoxin   KO K18917   mycoredoxin [EC:1.20.4.3] Organism msim  Mycobacterium simiae Brite KEGG Orthology (KO) [BR:msim00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     MSIM_12080 Enzymes [BR:msim01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      MSIM_12080 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_2 Thioredoxin_2 Thioredoxin GST_N_3 Glrx-like SH3BGR Thioredoxin_9 Zn_ribbon_TOP3B Motif Other DBs NCBI-ProteinID:  BBX39757 LinkDB All DBs Position 1306003..1306257 Genome browser AA seq 84 aa AA seqDB search MSSAPITVYTTSWCGYCHRLMTVLKSNNIAYEAVDIEHDPAAAEFVSSVNGGNRTVPTVK FADGSTLTNPSAAEVKAKLAAVSG NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgagcagcgctccgatcaccgtttacacgacgtcatggtgtggctactgccaccggctc atgaccgtgctcaagtccaacaacatcgcctatgaggcagtcgacatcgaacacgaccca gcggccgcggaatttgtcagttcggtcaacggcggcaaccggacggtgccaacagtgaag ttcgccgacgggtcgaccctgaccaatcccagcgctgccgaggtcaaggcaaagctggcc gccgtgtccggctga

DBGET integrated database retrieval system