Mycobacterium simiae: MSIM_40080 Help Entry MSIM_40080        CDS       T07396                                  Symbol mbtL Name (GenBank) acyl carrier protein MbtL   KO K02078   acyl carrier protein Organism msim  Mycobacterium simiae Pathway msim01100   Metabolic pathways msim01110   Biosynthesis of secondary metabolites Module msim_M00885   Meromycolic acid biosynthesis, initiation and elongation FAS II (KasA) msim_M00886   Meromycolic acid biosynthesis, initiation and elongation FAS II (KasA and KasB) Brite KEGG Orthology (KO) [BR:msim00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     MSIM_40080 (mbtL)    00074 Mycolic acid biosynthesis     MSIM_40080 (mbtL)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     MSIM_40080 (mbtL) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  BBX42557 LinkDB All DBs Position 4242630..4242881 Genome browser AA seq 83 aa AA seqDB search MASSTAVTAALQNILRDDLNVDMSRVSPQARLIDDVGLDSVAFAVGMVAIEERLGVVLSE EELLACDTVGDLDAAIAAKSRNE NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atggcatcctctaccgcggtgaccgctgcgctgcagaatattttgcgtgacgacctcaac gtcgatatgagccgggtgagcccccaggcgcggctgatcgatgatgtcggactcgactcg gtggcatttgctgtcgggatggtcgcgatcgaagaacgcctcggcgtggtgctgtctgaa gaagagctactagcctgcgacaccgtcggcgatctggatgctgccatcgcggcgaaatcc cgcaatgagtga

DBGET integrated database retrieval system