Magnolia sinica: 131226608 Help Entry 131226608         CDS       T09699                                  Name (RefSeq) calmodulin isoform X1   KO K02183   calmodulin Organism msin  Magnolia sinica Pathway msin04016   MAPK signaling pathway - plant msin04070   Phosphatidylinositol signaling system msin04075   Plant hormone signal transduction Brite KEGG Orthology (KO) [BR:msin00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     131226608    04070 Phosphatidylinositol signaling system     131226608    04075 Plant hormone signal transduction     131226608  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:msin01009]     131226608   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:msin04131]     131226608    03036 Chromosome and associated proteins [BR:msin03036]     131226608   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:msin04147]     131226608 Protein phosphatases and associated proteins [BR:msin01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      131226608 Membrane trafficking [BR:msin04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     131226608 Chromosome and associated proteins [BR:msin03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      131226608 Exosome [BR:msin04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    131226608 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 AIF-1 EF-hand_9 EH SPARC_Ca_bdg EF_EFCAB10_C DUF5580_M UPF0154 EF-hand_11 Dockerin_1 Caleosin RNA_pol_Rpb4 EFhand_Ca_insen SurA_N_3 SurA_N_2 SPEF2_C FCaBP_EF-hand MotA_activ GIP1_N Fe_hyd_lg_C Poly_export DUF6279 Motif Other DBs NCBI-GeneID:  131226608 NCBI-ProteinID:  XP_058078164 LinkDB All DBs Position 15:68132037..68146905 Genome browser AA seq 149 aa AA seqDB search MAEQLTEEQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADQ NGTIDFPEFLNLMARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGEKLTDE EVDEMIREADMDGDGQVNYEEFVRMMLAK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggcagagcagctaacggaagagcagatctctgaattcaaggaagctttcagtctcttt gacaaggacggagatggttgcatcactaccaaagaattgggtacggtgatgagatctttg gggcaaaatccaactgaagctgagctccaagatatgatcaatgaggttgatgctgaccaa aatggaactatcgatttccctgagttcttgaatttgatggcacgtaaaatgaaagacact gattctgaggaggagctgaaggaggctttcaaggtctttgacaaggaccaaaatgggttc atttctgctgcagagcttcgacatgtgatgaccaatctgggagagaagttgacagacgag gaagtggatgagatgatccgagaagcggacatggacggcgatggtcaggtgaactatgaa gaatttgtgaggatgatgctggccaagtaa

DBGET integrated database retrieval system