Methanosarcina siciliae C2J: MSSAC_1446 Help Entry MSSAC_1446        CDS       T03863                                  Name (GenBank) NADH dehydrogenase subunit J   KO K22165   F420H2 dehydrogenase subunit J [EC:1.5.98.3] Organism msj  Methanosarcina siciliae C2J Brite KEGG Orthology (KO) [BR:msj00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     MSSAC_1446 Enzymes [BR:msj01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.98  With other, known, physiological acceptors     1.5.98.3  coenzyme F420:methanophenazine dehydrogenase      MSSAC_1446 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Oxidored_q3 MASE6 MbhD Motif Other DBs NCBI-ProteinID:  AKB36036 UniProt:  A0A0E3LCS6 LinkDB All DBs Position complement(1725120..1725410) Genome browser AA seq 96 aa AA seqDB search MIGLETVGAALEMAVFGLLALVTVFFAIFVVIAKDVVRAGLALIMCMFGVAVLYILLNAQ FLGIIQVLVYIGAIGVLILFAVMLTKRELGGGSRAN NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgatcggacttgaaacggttggagcagctctggaaatggctgtcttcggactccttgca cttgtcacggtcttctttgcaatttttgtggttattgcaaaagatgtcgttagagccggg cttgccctgattatgtgcatgttcggtgttgcagtactttacattctcttaaacgctcag ttccttggaataattcaggtgctggtctatataggagcaatcggagtgctgatcctcttt gcggttatgcttacaaaacgcgaactcggaggtgggtctcgtgcgaattaa

DBGET integrated database retrieval system