Methanosarcina siciliae C2J: MSSAC_3526 Help Entry MSSAC_3526        CDS       T03863                                  Name (GenBank) SSU ribosomal protein S27Ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism msj  Methanosarcina siciliae C2J Pathway msj03010   Ribosome Brite KEGG Orthology (KO) [BR:msj00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     MSSAC_3526   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     MSSAC_3526  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:msj03011]     MSSAC_3526    04121 Ubiquitin system [BR:msj04121]     MSSAC_3526   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:msj04147]     MSSAC_3526 Ribosome [BR:msj03011]  Ribosomal proteins   Eukaryotes    Small subunit     MSSAC_3526   Archaea     MSSAC_3526 Ubiquitin system [BR:msj04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    MSSAC_3526 Exosome [BR:msj04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    MSSAC_3526   Exosomal proteins of colorectal cancer cells    MSSAC_3526 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Zn_ribbon_Nudix Ribosomal_L37e IBR_1 DUF6671 Zn_ribbon_RPB9 IBR Zn_Ribbon_TF Cas12f1-like_TNB Zn_ribbon_3 DUF1451 MqsA_antitoxin Zn_ribbon_IS1595 Zn_ribbon_NOB1 Motif Other DBs NCBI-ProteinID:  AKB38116 UniProt:  A0A0E3LDZ2 LinkDB All DBs Position 4334405..4334554 Genome browser AA seq 49 aa AA seqDB search MAVKDYYKVQGDSVTRLKQFCPRCGPGIFLADHKNRLACGKCGYTEFKK NT seq 150 nt NT seq  +upstreamnt  +downstreamnt atggcagtaaaagattactacaaagtccagggcgactccgtaaccagactcaaacaattc tgtcccagatgcggacccggcatattccttgccgaccacaaaaaccgccttgcctgcgga aagtgcggctacaccgaattcaagaaataa

DBGET integrated database retrieval system