Methylocella silvestris: Msil_1224 Help Entry Msil_1224         CDS       T00802                                  Name (GenBank) conserved hypothetical protein   KO K02078   acyl carrier protein Organism msl  Methylocella silvestris Pathway msl01100   Metabolic pathways msl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:msl00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Msil_1224    00074 Mycolic acid biosynthesis     Msil_1224   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Msil_1224 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding HARE-HTH DUF2240 DUF2470 DUF2680 Motif Other DBs NCBI-ProteinID:  ACK50193 UniProt:  B8EPI8 LinkDB All DBs Position complement(1308212..1308481) Genome browser AA seq 89 aa AA seqDB search METKDLDQTELVNQIIDVIVKEGMIDREKVTPDATIESLDLKSIDIVMILTAIEDKFDVY IPMDGPFHEAKDIKSLIDAIAAYIIKEKS NT seq 270 nt NT seq  +upstreamnt  +downstreamnt gtggaaacgaaggatctcgatcaaaccgagctcgtcaatcagattatcgacgtcatcgtc aaggaaggcatgatcgatcgggagaaagtcacgcccgacgcgacgattgaaagcctcgac ctcaaatcgatcgacatcgtgatgattctgacggccatcgaagataaatttgacgtctat attccgatggacggcccgttccacgaggccaaggacatcaaaagcctgatcgacgccatc gcggcctatatcatcaaagaaaaatcataa

DBGET integrated database retrieval system