Methylocella silvestris: Msil_1481 Help Entry Msil_1481         CDS       T00802                                  Name (GenBank) 4-oxalocrotonate tautomerase   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism msl  Methylocella silvestris Pathway msl00362   Benzoate degradation msl00621   Dioxin degradation msl00622   Xylene degradation msl01100   Metabolic pathways msl01120   Microbial metabolism in diverse environments msl01220   Degradation of aromatic compounds Module msl_M00569   Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA Brite KEGG Orthology (KO) [BR:msl00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     Msil_1481    00622 Xylene degradation     Msil_1481    00621 Dioxin degradation     Msil_1481 Enzymes [BR:msl01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      Msil_1481 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tautomerase Tautomerase_2 Motif Other DBs NCBI-ProteinID:  ACK50439 UniProt:  B8ESV4 LinkDB All DBs Position 1599722..1599919 Genome browser AA seq 65 aa AA seqDB search MPIVEITLIEGRSDEAKERLHAKVADAIHEAIDAPKEAIRIIIREVPPLHFSAGGLAKAK PAAKS NT seq 198 nt NT seq  +upstreamnt  +downstreamnt atgcccatcgtcgaaatcacactgatcgaaggccgctcggacgaggcgaaggaacgcctc catgcgaaggtcgccgacgccattcacgaggcgatcgacgcgccgaaagaagcgatccgc atcatcatccgcgaagtgccgccgctgcatttttcggccggcggcttggccaaagcgaag cctgcggcgaaatcatga

DBGET integrated database retrieval system