Methylocella silvestris: Msil_2539
Help
Entry
Msil_2539 CDS
T00802
Name
(GenBank) DNA polymerase III, epsilon subunit
KO
K02342
DNA polymerase III subunit epsilon [EC:
2.7.7.7
]
Organism
msl
Methylocella silvestris
Pathway
msl03030
DNA replication
msl03430
Mismatch repair
msl03440
Homologous recombination
Brite
KEGG Orthology (KO) [BR:
msl00001
]
09120 Genetic Information Processing
09124 Replication and repair
03030 DNA replication
Msil_2539
03430 Mismatch repair
Msil_2539
03440 Homologous recombination
Msil_2539
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03032 DNA replication proteins [BR:
msl03032
]
Msil_2539
03400 DNA repair and recombination proteins [BR:
msl03400
]
Msil_2539
Enzymes [BR:
msl01000
]
2. Transferases
2.7 Transferring phosphorus-containing groups
2.7.7 Nucleotidyltransferases
2.7.7.7 DNA-directed DNA polymerase
Msil_2539
DNA replication proteins [BR:
msl03032
]
Prokaryotic type
DNA Replication Elongation Factors
Elongation factors (bacterial)
DNA polymerase III holoenzyme
Msil_2539
DNA repair and recombination proteins [BR:
msl03400
]
Prokaryotic type
SSBR (single strand breaks repair)
MMR (mismatch excision repair)
DNA polymerase III holoenzyme
Msil_2539
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
RNase_T
Rv2179c-like
RNase_H_2
DNA_pol_A_exo1
Motif
Other DBs
NCBI-ProteinID:
ACK51463
UniProt:
B8EM74
LinkDB
All DBs
Position
2774347..2775054
Genome browser
AA seq
235 aa
AA seq
DB search
MREIVLDTETTGLDPKQGHRIVEIGAVELLNSIPTGQSFHVYIHPERDMPDEAFRVHGIS
LEFLTGKPLFAEIVPALIDFLGEAKIIAHNAEFDFRFLNAEFLRAEAEPLAWERVVDTLA
LARRRFPGASNSLDALCARFGVDTSRRVKHGALLDAEILAEVYAELCGGRQAALVFGGGL
GSDAATEAALMRERPEPLAPQLSPQEVAAHAAFVATLGEKAIWQAYLSPPAAAAE
NT seq
708 nt
NT seq
+upstream
nt +downstream
nt
ttgcgcgaaatcgtcctcgatacggaaacgaccggcctcgatccaaagcagggccacagg
atcgtcgagatcggcgccgtcgagcttttgaactccattccgacggggcagtccttccac
gtctatatccaccccgagcgggacatgcccgacgaggcgttccgggtgcacggcatctcg
ctcgaatttctgaccggcaagccgctgttcgccgagatcgtccccgcgctcatcgatttt
ttgggcgaggcgaagatcatcgcccataacgccgaattcgatttccgctttctcaacgcc
gagtttttgcgcgcggaggccgagccgctggcctgggagcgggtggtcgacacgctggct
ttggcgcggcgcaggtttccgggggcctcgaacagcctcgacgcgctttgcgcgcgcttt
ggcgtcgatacctcgcgccgcgtcaaacatggcgctttgctcgacgccgagattctggcc
gaggtctatgccgaattgtgcggcggccggcaggcggcgcttgtcttcggcggcggcctc
ggctccgacgccgccacagaggccgcgctgatgcgcgagcgccccgagcctttggcgccg
cagctcagcccgcaagaagtcgccgcccatgccgcctttgtcgccaccctcggcgagaag
gcgatctggcaggcctatctgtcgcctcccgccgctgcggcggaatag
DBGET
integrated database retrieval system