KEGG   Methylocella silvestris: Msil_2539
Entry
Msil_2539         CDS       T00802                                 
Name
(GenBank) DNA polymerase III, epsilon subunit
  KO
K02342  DNA polymerase III subunit epsilon [EC:2.7.7.7]
Organism
msl  Methylocella silvestris
Pathway
msl03030  DNA replication
msl03430  Mismatch repair
msl03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:msl00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    Msil_2539
   03430 Mismatch repair
    Msil_2539
   03440 Homologous recombination
    Msil_2539
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:msl03032]
    Msil_2539
   03400 DNA repair and recombination proteins [BR:msl03400]
    Msil_2539
Enzymes [BR:msl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     Msil_2539
DNA replication proteins [BR:msl03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     Msil_2539
DNA repair and recombination proteins [BR:msl03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     Msil_2539
SSDB
Motif
Pfam: RNase_T Rv2179c-like RNase_H_2 DNA_pol_A_exo1
Other DBs
NCBI-ProteinID: ACK51463
UniProt: B8EM74
LinkDB
Position
2774347..2775054
AA seq 235 aa
MREIVLDTETTGLDPKQGHRIVEIGAVELLNSIPTGQSFHVYIHPERDMPDEAFRVHGIS
LEFLTGKPLFAEIVPALIDFLGEAKIIAHNAEFDFRFLNAEFLRAEAEPLAWERVVDTLA
LARRRFPGASNSLDALCARFGVDTSRRVKHGALLDAEILAEVYAELCGGRQAALVFGGGL
GSDAATEAALMRERPEPLAPQLSPQEVAAHAAFVATLGEKAIWQAYLSPPAAAAE
NT seq 708 nt   +upstreamnt  +downstreamnt
ttgcgcgaaatcgtcctcgatacggaaacgaccggcctcgatccaaagcagggccacagg
atcgtcgagatcggcgccgtcgagcttttgaactccattccgacggggcagtccttccac
gtctatatccaccccgagcgggacatgcccgacgaggcgttccgggtgcacggcatctcg
ctcgaatttctgaccggcaagccgctgttcgccgagatcgtccccgcgctcatcgatttt
ttgggcgaggcgaagatcatcgcccataacgccgaattcgatttccgctttctcaacgcc
gagtttttgcgcgcggaggccgagccgctggcctgggagcgggtggtcgacacgctggct
ttggcgcggcgcaggtttccgggggcctcgaacagcctcgacgcgctttgcgcgcgcttt
ggcgtcgatacctcgcgccgcgtcaaacatggcgctttgctcgacgccgagattctggcc
gaggtctatgccgaattgtgcggcggccggcaggcggcgcttgtcttcggcggcggcctc
ggctccgacgccgccacagaggccgcgctgatgcgcgagcgccccgagcctttggcgccg
cagctcagcccgcaagaagtcgccgcccatgccgcctttgtcgccaccctcggcgagaag
gcgatctggcaggcctatctgtcgcctcccgccgctgcggcggaatag

DBGET integrated database retrieval system