KEGG   Mycolicibacterium gilvum Spyr1: Mspyr1_01620
Entry
Mspyr1_01620      CDS       T01376                                 
Name
(GenBank) ring-hydroxylating dioxygenase, large terminal subunit
  KO
K11943  PAH dioxygenase large subunit [EC:1.13.11.-]
Organism
msp  Mycolicibacterium gilvum Spyr1
Pathway
msp00624  Polycyclic aromatic hydrocarbon degradation
msp01100  Metabolic pathways
msp01120  Microbial metabolism in diverse environments
msp01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:msp00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00624 Polycyclic aromatic hydrocarbon degradation
    Mspyr1_01620
Enzymes [BR:msp01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.-
     Mspyr1_01620
SSDB
Motif
Pfam: Ring_hydroxyl_A Rieske
Other DBs
NCBI-ProteinID: ADT96888
UniProt: E6TIS0
LinkDB
Position
162204..163571
AA seq 455 aa
MTTETTGTADATDPYLRRALREVADGLKVGRLPARVVSDPALHTIEMERIFGRAWVFLGH
ESELAKSGDFVVRHIGADSVIVCRDNSGRIQALSNSCRHRGALVCRAEMGNTAHFQCPYH
GWVYSNTGELVGVPAMSEAYPGGFDKSQWGLRHIPHVDSYAGFIFGSVDPKAPSLTDYLG
DTTFYLDLIAKKTAGGLEVIGAPHRWVMSANWKTAADNFVGDSYHTLFAHRSMVELGMAP
GDPNFASAPAEISLQNGHGVGVLGFPPTLADFPEYEGYPDEVVDQMATSYPSPVHKDLMR
RSSFIHGTVFPNLSFINVTLAQDHMSPPTPFITFRVWHPLSHDRMEVLSWFLVERDAPEW
LRDASQASYVNNFGPGGVFEQDDAEAWKAITESVQGPFAGAGLLNYEMGMDLTPLTDWPG
PGEALPSGYAEQNQRRFWGRWLEYMGQPPAFGGRA
NT seq 1368 nt   +upstreamnt  +downstreamnt
atgaccaccgaaacaaccggaacagctgacgcgaccgatccctacctgcggcgcgcgttg
cgggaggtagcggacgggctcaaggtcgggcgcttaccggcccgcgtcgtcagcgatccc
gcgctacacacgatcgagatggagcggatcttcgggcgcgcctgggtgtttctcggacac
gagtcggagttggccaagtccggcgacttcgtcgtgcggcacatcggggccgattcggtg
atcgtttgccgggacaactccggccgcatccaggcgctgtccaattcttgtcgccaccgt
ggtgcgctcgtgtgccgcgctgagatgggaaacaccgcgcacttccaatgcccgtaccac
ggctgggtgtacagcaacaccggagagctcgtcggcgtgccggcgatgagtgaggcctat
cccggcggcttcgacaagtcgcagtggggattacgtcacatcccccatgtcgactcgtac
gccggattcatcttcggcagcgtcgatccgaaggcgccgagcctgaccgactacctcggc
gacacgacgttctacctcgacctcattgcgaagaagacagcgggcggtctggaggtgata
ggggcaccgcatcgatgggtgatgtcagcgaactggaagacagccgccgacaattttgtc
ggcgactcctaccacaccctctttgctcaccgctcgatggtcgagctaggcatggcgccc
ggtgacccaaacttcgcgagcgcaccagcggagatctcgctgcagaacggccacggcgtc
ggcgtactcggctttccgcccacgctcgccgattttcccgagtacgagggataccccgac
gaagtcgtcgaccagatggcgacgtcctacccgtcgccggtacacaaggacctgatgcga
cgctcatcctttattcacggcaccgtgttcccgaatttgtcgttcatcaacgtgaccctc
gcgcaggaccacatgtcgccccctacccccttcatcacgttccgggtatggcatccgctc
tcccatgatcggatggaggtcctctcctggttcctggtcgaacgcgatgctccggaatgg
ttgcgcgatgcgtcccaggcgtcctacgtcaacaacttcggcccaggtggggttttcgaa
caggacgacgccgaggcatggaaggccatcaccgaatctgtccagggcccgttcgccggt
gcaggcctgctgaactacgaaatgggcatggacttgactccgctcaccgactggccaggg
ccgggagaggccctcccgagcgggtacgccgagcagaatcagcggcggttttgggggaga
tggctggaatacatgggtcagcctcccgcattcggcgggcgtgcttga

DBGET integrated database retrieval system