Mycobacterium spongiae: F6B93_15010 Help Entry F6B93_15010       CDS       T07689                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mspg  Mycobacterium spongiae Pathway mspg01100   Metabolic pathways mspg01110   Biosynthesis of secondary metabolites Module mspg_M00885   Meromycolic acid biosynthesis, initiation and elongation FAS II (KasA) mspg_M00886   Meromycolic acid biosynthesis, initiation and elongation FAS II (KasA and KasB) Brite KEGG Orthology (KO) [BR:mspg00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     F6B93_15010    00074 Mycolic acid biosynthesis     F6B93_15010   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     F6B93_15010 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QUR69847 UniProt:  A0A975K1Y3 LinkDB All DBs Position complement(3686115..3686375) Genome browser AA seq 86 aa AA seqDB search MMDRTPDAVSAALEEILRDDLRVDVSGVTTQSRLVDDVGLDSVAFAVGMVAIEDKLGVAL SEEDLLGCDTVGDLEAAIRARGQAIR NT seq 261 nt NT seq  +upstreamnt  +downstreamnt ctgatggaccgcactccggatgcggtcagtgccgccctcgaggagattcttcgtgacgat ctcagagtcgatgtcagcggcgtgaccacgcagtcccggctggtcgacgacgtcggactg gactcggtcgcgttcgcggtgggaatggtggcgattgaggacaaactgggggtggcgctt tccgaggaagatctgctcggctgtgacacagtcggtgacctggaagcggctatccgggcc aggggtcaggccatccgatga

DBGET integrated database retrieval system