Microbulbifer spongiae: M8T91_18185
Help
Entry
M8T91_18185 CDS
T10475
Symbol
coaD
Name
(GenBank) pantetheine-phosphate adenylyltransferase
KO
K00954
pantetheine-phosphate adenylyltransferase [EC:
2.7.7.3
]
Organism
mspn Microbulbifer spongiae
Pathway
mspn00770
Pantothenate and CoA biosynthesis
mspn01100
Metabolic pathways
mspn01240
Biosynthesis of cofactors
Module
mspn_M00120
Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:
mspn00001
]
09100 Metabolism
09108 Metabolism of cofactors and vitamins
00770 Pantothenate and CoA biosynthesis
M8T91_18185 (coaD)
Enzymes [BR:
mspn01000
]
2. Transferases
2.7 Transferring phosphorus-containing groups
2.7.7 Nucleotidyltransferases
2.7.7.3 pantetheine-phosphate adenylyltransferase
M8T91_18185 (coaD)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
CTP_transf_like
Citrate_ly_lig
FAD_binding_5
Motif
Other DBs
NCBI-ProteinID:
WKD49792
UniProt:
A0ABY9ECB2
LinkDB
All DBs
Position
complement(4376203..4376679)
Genome browser
AA seq
158 aa
AA seq
DB search
MKKVVYPGTFDPITNGHLDLVERACRLFDQVIVAVAASSRKNPLFTLDERVELSQQVLGH
LPNVEVIGFDILLADLVHQVNAYGVLRGLRAVSDFEYEFQLANMNRQLAPNMESLFLTPA
EHLSYISSSLVREIASLGGDVAKFVPPTVQTALEEKFR
NT seq
477 nt
NT seq
+upstream
nt +downstream
nt
atgaaaaaagtcgtctatcccgggactttcgatcccattaccaacggccatttggacctc
gttgaacgggcctgccgcctgtttgaccaggtcatcgtcgctgtggccgccagcagtcgc
aagaatccgctttttaccctggatgagcgcgtcgaactctctcagcaggtactcggtcat
ctgcccaatgtggaagtgatcggtttcgatatcctgctcgccgatctggtacatcaggtc
aatgcctacggtgtattgcgcggtctgcgcgccgtttccgatttcgagtacgagttccag
ctggccaatatgaaccgccagctggcgcccaatatggaaagcctgtttctgaccccggca
gagcatttatcctacatttcctcgtccctggtccgggaaattgcctctctgggtggggat
gtggccaaatttgttccgccaacagttcagactgcgcttgaggagaaattccgctaa
DBGET
integrated database retrieval system