Mycetocola spongiae: KXZ72_10885 Help Entry KXZ72_10885       CDS       T08087                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mspo  Mycetocola spongiae Pathway mspo01100   Metabolic pathways mspo01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mspo00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     KXZ72_10885    00074 Mycolic acid biosynthesis     KXZ72_10885   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     KXZ72_10885 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  UCR88461 LinkDB All DBs Position 2384314..2384601 Genome browser AA seq 95 aa AA seqDB search MTTHAQILERATARTQLNSTLKRLIAEGLDLPVSGDQIEDDQPLFGRGLELDSLDTLEIV SLVEEEFEVYITDDEKFVFGSINKICDLIEREQAK NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atgactacccacgcccagatcctggagcgggccaccgcccgcacgcagctgaatagcacc ctgaagcgcctgatcgcggagggccttgaccttcccgtgagcggggaccagatcgaggat gaccagccgctctttggccgcggactcgaactcgactcgctggacaccctcgaaatcgtc agcctcgtggaggaggagtttgaggtgtatatcaccgatgacgagaagtttgtttttggt tcgattaataagatctgcgacctgatcgagcgcgagcaggccaagtga

DBGET integrated database retrieval system