KEGG   Methylosinus sporium: MSP5_002756
Entry
MSP5_002756       CDS       T11225                                 
Symbol
dnaQ
Name
(GenBank) DNA polymerase III subunit epsilon
  KO
K02342  DNA polymerase III subunit epsilon [EC:2.7.7.7]
Organism
mspr  Methylosinus sporium
Pathway
mspr03030  DNA replication
mspr03430  Mismatch repair
mspr03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:mspr00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    MSP5_002756 (dnaQ)
   03430 Mismatch repair
    MSP5_002756 (dnaQ)
   03440 Homologous recombination
    MSP5_002756 (dnaQ)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mspr03032]
    MSP5_002756 (dnaQ)
   03400 DNA repair and recombination proteins [BR:mspr03400]
    MSP5_002756 (dnaQ)
Enzymes [BR:mspr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     MSP5_002756 (dnaQ)
DNA replication proteins [BR:mspr03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     MSP5_002756 (dnaQ)
DNA repair and recombination proteins [BR:mspr03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     MSP5_002756 (dnaQ)
SSDB
Motif
Pfam: RNase_T Rv2179c-like RNase_H_2 DNA_pol_A_exo1
Other DBs
NCBI-ProteinID: XWX55697
LinkDB
Position
complement(2892229..2892969)
AA seq 246 aa
MREIVFDTETTGLDPTKGHRIVEIGAVEISNLIPSGRTFHFYLDPERDMPEEAFRVHGLS
SAFLTGQKKFREIAQSFLEFVGDAALVAHNAEFDMRFVNFELGLLGMEAIPFDRVVDTLT
LARRRHPGASNTLDALCQRYGVDLTRRDKHGALLDAGLLAEVYAELMGGRQSALILQADA
ATLAEAGGGELLRSRPQKLAPLLTEAERAAHEAFIAKLGKEPMWLRYFAQPEEMEAGFAS
GIEKRA
NT seq 741 nt   +upstreamnt  +downstreamnt
atgcgtgagatcgtcttcgacacggagacgaccggtctcgacccgaccaaaggtcatcgc
atcgtcgagatcggcgccgtcgagatctccaatctgatcccttccggccgcacgttccat
ttctatctcgatccagaacgcgacatgccggaggaggcgtttcgcgtgcatggcctctcc
tcggcctttctcaccggccagaagaaatttcgcgaaatcgcgcagagctttctcgaattc
gtcggcgacgccgccctcgtcgcgcacaatgccgaattcgacatgcgcttcgtcaatttc
gagctcggcctgttggggatggaggcgatccccttcgatcgcgtcgtcgatacgctgacc
ctcgcccgccgccggcatccgggcgcctccaacacgctggacgcgctctgccagcgttat
ggcgtcgatctcacgcgccgcgacaagcatggcgcgctgctggacgccggcctgctggcg
gaagtctatgcggagctgatgggcggccgccaatccgcgctgatattgcaagcggacgct
gcgactctggcggaagcgggcggcggcgaattgctgcgcagccgtccgcaaaagctcgcg
ccgctgctcaccgaggcggagcgcgccgcccatgaggccttcatcgccaagctgggcaag
gagccgatgtggctgcgctatttcgcgcagccggaagagatggaggcgggatttgcctcg
ggaatagagaagcgagcctga

DBGET integrated database retrieval system