Methylosinus sporium: MSP5_002804 Help Entry MSP5_002804       CDS       T11225                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mspr  Methylosinus sporium Pathway mspr00998   Biosynthesis of various antibiotics mspr01100   Metabolic pathways mspr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mspr00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     MSP5_002804    00074 Mycolic acid biosynthesis     MSP5_002804   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     MSP5_002804 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N DUF1493 Ribosomal_L50 ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  XWX55745 LinkDB All DBs Position 2942776..2943015 Genome browser AA seq 79 aa AA seqDB search MSDIAPRVKSIVVEHLGVKEEEVKPEASFVDDLGADSLDTVELVMAFEEEFGVEIPDEEA EKINTVGDAITYLEKAKAA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgccccgcgcgttaagagtatcgttgtcgaacatctcggcgtcaaagaa gaagaggtgaagccggaggcgtctttcgtcgacgatctcggggccgattctctcgatacc gtcgagctggtcatggccttcgaggaggagttcggcgtcgagatcccggacgaagaggcc gagaagatcaacacggtcggcgacgccatcacctatctcgaaaaagccaaggcggcttga

DBGET integrated database retrieval system