Marinobacter salarius: AU15_19145
Help
Entry
AU15_19145 CDS
T03593
Name
(GenBank) 50S ribosomal protein L18
KO
K02881
large subunit ribosomal protein L18
Organism
msr
Marinobacter salarius
Pathway
msr03010
Ribosome
Brite
KEGG Orthology (KO) [BR:
msr00001
]
09120 Genetic Information Processing
09122 Translation
03010 Ribosome
AU15_19145
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03011 Ribosome [BR:
msr03011
]
AU15_19145
Ribosome [BR:
msr03011
]
Ribosomal proteins
Mitochondria/ Chloroplast
Large subunit
AU15_19145
Bacteria
AU15_19145
Archaea
AU15_19145
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Ribosomal_L18p
TGS
DUF7712
Motif
Other DBs
NCBI-ProteinID:
AHI32573
UniProt:
W5Z258
LinkDB
All DBs
Position
3974639..3974986
Genome browser
AA seq
115 aa
AA seq
DB search
MSANNERLRRARKVRMKIRKLGTNRLCVHRTPRHMYAQVTTADGSKVLAAASTLDKDLRQ
GATGNVDAAKKVGQLIAERAKAAGVEQVAFDRSGYRYHGRVQALADAAREAGLQF
NT seq
348 nt
NT seq
+upstream
nt +downstream
nt
atgagcgcgaataacgaaagattgcgtcgcgcacgcaaagtgcgcatgaagatccgtaag
ctgggcaccaaccgcctgtgtgtacatcgtacaccccggcacatgtacgcccaggttacc
actgcagacggcagcaaggtgctggcggctgcctccacgttggataaggacctgcgccag
ggtgcaaccggtaacgtggacgctgccaaaaaggtcggtcagttgattgctgagcgtgcc
aaggcagcaggtgtagagcaggtcgcttttgaccgctccggttaccgttatcatggtcgc
gtccaggctctggccgacgcagcccgtgaagctggcttgcaattctaa
DBGET
integrated database retrieval system