Methanosphaera stadtmanae: Msp_0620 Help Entry Msp_0620          CDS       T00313                                  Name (GenBank) 30S ribosomal protein S27Ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism mst  Methanosphaera stadtmanae Pathway mst03010   Ribosome Brite KEGG Orthology (KO) [BR:mst00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     Msp_0620   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     Msp_0620  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:mst03011]     Msp_0620    04121 Ubiquitin system [BR:mst04121]     Msp_0620   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mst04147]     Msp_0620 Ribosome [BR:mst03011]  Ribosomal proteins   Eukaryotes    Small subunit     Msp_0620   Archaea     Msp_0620 Ubiquitin system [BR:mst04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    Msp_0620 Exosome [BR:mst04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    Msp_0620   Exosomal proteins of colorectal cancer cells    Msp_0620 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 NCD3G PilJ_Pilin Motif Other DBs NCBI-ProteinID:  ABC57018 UniProt:  Q2NGN5 LinkDB All DBs Position complement(734037..734192) Genome browser AA seq 51 aa AA seqDB search MSKKYELYEVKDGKIVRKNPECVRCSHGIFMADHGDRYACGRCGYTQWKNE NT seq 156 nt NT seq  +upstreamnt  +downstreamnt atgtctaaaaaatatgaattatatgaagttaaagatggtaaaattgtaagaaaaaatcct gaatgtgtaagatgttcacatggtattttcatggctgaccatggagatagatatgcatgt ggtcgttgtggatacacacaatggaaaaatgaataa

DBGET integrated database retrieval system