Mycobacterium stephanolepidis: MSTE_01691 Help Entry MSTE_01691        CDS       T05257                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism mste  Mycobacterium stephanolepidis Pathway mste01100   Metabolic pathways mste01110   Biosynthesis of secondary metabolites Module mste_M00885   Meromycolic acid biosynthesis, initiation and elongation FAS II (KasA) Brite KEGG Orthology (KO) [BR:mste00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     MSTE_01691    00074 Mycolic acid biosynthesis     MSTE_01691   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     MSTE_01691 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  BAX97011 UniProt:  A0A1Z4EVN2 LinkDB All DBs Position 1673614..1673856 Genome browser AA seq 80 aa AA seqDB search METTSEVREFLIEFIAEELEMPTGDVNDFSELVGDLGFDSLSFAVGVSEIKGRFGIQLTK DDVFECKTLGALIELVESRL NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atggaaaccacgtcagaagtccgcgagttcctcatcgagttcatcgccgaggaactcgag atgcccaccggggatgtcaacgacttctccgagttggtgggtgatctcggattcgactcg ctatcgttcgcggtaggagtttcggagatcaagggccgcttcggtattcaactgaccaag gacgatgtcttcgagtgcaagacactcggcgcgttgatcgagctggtggagagccggctg tga

DBGET integrated database retrieval system