Mycobacterium stephanolepidis: MSTE_04256 Help Entry MSTE_04256        CDS       T05257                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mste  Mycobacterium stephanolepidis Pathway mste01100   Metabolic pathways mste01110   Biosynthesis of secondary metabolites Module mste_M00885   Meromycolic acid biosynthesis, initiation and elongation FAS II (KasA) Brite KEGG Orthology (KO) [BR:mste00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     MSTE_04256    00074 Mycolic acid biosynthesis     MSTE_04256   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     MSTE_04256 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  BAX99550 UniProt:  A0A1Z4F2W8 LinkDB All DBs Position complement(4192671..4192943) Genome browser AA seq 90 aa AA seqDB search MSTEVAEKLEKILRGELAVSANEITRDKLLIDDLGLDSVGFALGLVLIEEQFGVTLTEDQ LLVCDSFGDLVDIVSAGQAATSPATNALAE NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgtcgactgaagttgccgagaaactcgagaagatcttgcgtggagagctcgcggtcagc gcgaatgagattacccgcgacaagttgttgatcgatgatctgggactcgactcggtggga ttcgcgctgggcctcgtcctcatcgaggagcagttcggcgtcactcttaccgaagatcag ctactcgtgtgcgattccttcggcgaccttgtcgacatcgtctcggcagggcaggccgcc acctcacccgcaaccaacgcgctcgccgagtag

DBGET integrated database retrieval system