Mycobacterium stomatepiae: MSTO_52020 Help Entry MSTO_52020        CDS       T07145                                  Name (GenBank) hypothetical protein   KO K00626   acetyl-CoA C-acetyltransferase [EC:2.3.1.9] Organism msto  Mycobacterium stomatepiae Pathway msto00071   Fatty acid degradation msto00280   Valine, leucine and isoleucine degradation msto00310   Lysine degradation msto00362   Benzoate degradation msto00380   Tryptophan metabolism msto00620   Pyruvate metabolism msto00630   Glyoxylate and dicarboxylate metabolism msto00650   Butanoate metabolism msto00720   Other carbon fixation pathways msto00900   Terpenoid backbone biosynthesis msto01100   Metabolic pathways msto01110   Biosynthesis of secondary metabolites msto01120   Microbial metabolism in diverse environments msto01200   Carbon metabolism msto01212   Fatty acid metabolism msto02020   Two-component system Brite KEGG Orthology (KO) [BR:msto00001]  09100 Metabolism   09101 Carbohydrate metabolism    00620 Pyruvate metabolism     MSTO_52020    00630 Glyoxylate and dicarboxylate metabolism     MSTO_52020    00650 Butanoate metabolism     MSTO_52020   09102 Energy metabolism    00720 Other carbon fixation pathways     MSTO_52020   09103 Lipid metabolism    00071 Fatty acid degradation     MSTO_52020   09105 Amino acid metabolism    00280 Valine, leucine and isoleucine degradation     MSTO_52020    00310 Lysine degradation     MSTO_52020    00380 Tryptophan metabolism     MSTO_52020   09109 Metabolism of terpenoids and polyketides    00900 Terpenoid backbone biosynthesis     MSTO_52020   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     MSTO_52020  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     MSTO_52020  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:msto04147]     MSTO_52020 Enzymes [BR:msto01000]  2. Transferases   2.3  Acyltransferases    2.3.1  Transferring groups other than aminoacyl groups     2.3.1.9  acetyl-CoA C-acetyltransferase      MSTO_52020 Exosome [BR:msto04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    MSTO_52020 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Thiolase_C Thiolase_C_1 Motif Other DBs NCBI-ProteinID:  BBY24997 UniProt:  A0A7I7QFW4 LinkDB All DBs Position 5247178..5247582 Genome browser AA seq 134 aa AA seqDB search MSAEKAKDLGLTPIAKVHTATLAGADPVIMLTAPIPATQKVLKRSGLSISDIGAYEVNEA FAPVPLAWLKDIGADEKKLNPNGGAIALGHPLGGSGARIMTTLVYHMRDKGIRYGLQTMC EGGGQANATIVELL NT seq 405 nt NT seq  +upstreamnt  +downstreamnt atgtccgcggagaaggccaaggacttgggcctcacaccaattgctaaggtgcacaccgca accctggccggcgccgacccggtcatcatgctgaccgcgccgatcccggccacccagaaa gtgctgaagcggtccggcctgtcgatcagcgacatcggggcatacgaggtcaacgaggcg ttcgcacctgttccgctggcgtggctcaaagacatcggcgccgacgagaagaagctcaac cccaacggcggtgcgatcgcgctcggtcacccgctcggcggctccggcgcgcggatcatg accacgctggtctaccacatgcgggacaaggggattcgctacggcctacagacgatgtgt gagggtggtggccaggccaacgccaccattgtggagctcctgtga

DBGET integrated database retrieval system