Mycobacterium stomatepiae: MSTO_54660 Help Entry MSTO_54660        CDS       T07145                                  Symbol mbtL Name (GenBank) acyl carrier protein MbtL   KO K02078   acyl carrier protein Organism msto  Mycobacterium stomatepiae Pathway msto01100   Metabolic pathways msto01110   Biosynthesis of secondary metabolites Module msto_M00885   Meromycolic acid biosynthesis, initiation and elongation FAS II (KasA) msto_M00886   Meromycolic acid biosynthesis, initiation and elongation FAS II (KasA and KasB) Brite KEGG Orthology (KO) [BR:msto00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     MSTO_54660 (mbtL)    00074 Mycolic acid biosynthesis     MSTO_54660 (mbtL)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     MSTO_54660 (mbtL) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  BBY25261 UniProt:  A0A7I7QGA9 LinkDB All DBs Position 5521965..5522213 Genome browser AA seq 82 aa AA seqDB search MASSSSAVTSALQSILRDDLNVDMTRVTPEARLIDDVGLDSVAFAVGMVAIEERLGVALS EEELLTCDTVGDVDAAIAAKTP NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggcctcctcttcttccgcggtgaccagtgcgctgcaaagcattcttcgcgacgacctc aacgtcgacatgacccgggtcaccccggaagccagactgatcgacgatgtcggcttggac tcggtcgcctttgctgtcggcatggtcgccatcgaggagcggcttggtgtcgcgctctcc gaggaagagctcctgacctgcgacaccgtcggcgacgtggacgcggcgatcgcggcgaaa acaccgtaa

DBGET integrated database retrieval system