Mannheimia succiniciproducens: MS0458 Help Entry MS0458            CDS       T00201                                  Symbol groS Name (GenBank) GroS protein   KO K04078   chaperonin GroES Organism msu  Mannheimia succiniciproducens Brite KEGG Orthology (KO) [BR:msu00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:msu03110]     MS0458 (groS)    03029 Mitochondrial biogenesis [BR:msu03029]     MS0458 (groS) Chaperones and folding catalysts [BR:msu03110]  Heat shock proteins   HSP10    MS0458 (groS) Mitochondrial biogenesis [BR:msu03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     MS0458 (groS) SSDB OrthologParalogGFIT Motif Pfam:  Cpn10 DUF7205 Motif Other DBs NCBI-ProteinID:  AAU37065 UniProt:  Q65VE5 LinkDB All DBs Position 425787..425957 Genome browser AA seq 56 aa AA seqDB search MAVGKGRVLENGTVQPLDVKVGDTVIFNEGYGVKAEKIDGEEVLIISESDILAIVE NT seq 171 nt NT seq  +upstreamnt  +downstreamnt ttggcggtgggcaaaggtcgcgtacttgaaaacggcacggtacagcctttagacgtcaaa gtgggcgacacggtaattttcaacgaaggttacggcgtaaaagcggaaaaaattgacggc gaagaagtgttaatcatttctgaaagcgatattttggcgattgttgaataa

DBGET integrated database retrieval system