Methanobacterium subterraneum: BK009_05940 Help Entry BK009_05940       CDS       T05275                                  Name (GenBank) 30S ribosomal protein S27ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism msub  Methanobacterium subterraneum Pathway msub03010   Ribosome Brite KEGG Orthology (KO) [BR:msub00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     BK009_05940   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     BK009_05940  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:msub03011]     BK009_05940    04121 Ubiquitin system [BR:msub04121]     BK009_05940   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:msub04147]     BK009_05940 Ribosome [BR:msub03011]  Ribosomal proteins   Eukaryotes    Small subunit     BK009_05940   Archaea     BK009_05940 Ubiquitin system [BR:msub04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    BK009_05940 Exosome [BR:msub04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    BK009_05940   Exosomal proteins of colorectal cancer cells    BK009_05940 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 NCD3G Alsin_RLD Motif Other DBs NCBI-ProteinID:  AUB60264 UniProt:  A0A2H4VCP9 LinkDB All DBs Position 1248447..1248611 Genome browser AA seq 54 aa AA seqDB search MKKFELYEVKDNKIIRKNPECVRCSHGVFMADHGDRYACGKCGYTQWKGKEGKK NT seq 165 nt NT seq  +upstreamnt  +downstreamnt atgaaaaaattcgaattatacgaagttaaagataataaaatcatccgtaaaaaccctgaa tgtgtgcgttgttcccatggtgttttcatggcagaccacggagaccgatacgcttgtggt aaatgcggttacacccagtggaaaggtaaagaaggtaaaaaataa

DBGET integrated database retrieval system