Microbacterium sufflavum: KV394_11660
Help
Entry
KV394_11660 CDS
T10224
Name
(GenBank) pyridoxal phosphate-dependent aminotransferase
KO
K14260
alanine-synthesizing transaminase [EC:
2.6.1.66
2.6.1.2
]
Organism
msuf Microbacterium sufflavum
Pathway
msuf00220
Arginine biosynthesis
msuf00250
Alanine, aspartate and glutamate metabolism
msuf00290
Valine, leucine and isoleucine biosynthesis
msuf01100
Metabolic pathways
msuf01110
Biosynthesis of secondary metabolites
msuf01210
2-Oxocarboxylic acid metabolism
msuf01230
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:
msuf00001
]
09100 Metabolism
09105 Amino acid metabolism
00250 Alanine, aspartate and glutamate metabolism
KV394_11660
00290 Valine, leucine and isoleucine biosynthesis
KV394_11660
00220 Arginine biosynthesis
KV394_11660
09180 Brite Hierarchies
09181 Protein families: metabolism
01007 Amino acid related enzymes [BR:
msuf01007
]
KV394_11660
Enzymes [BR:
msuf01000
]
2. Transferases
2.6 Transferring nitrogenous groups
2.6.1 Transaminases
2.6.1.2 alanine transaminase
KV394_11660
2.6.1.66 valine---pyruvate transaminase
KV394_11660
Amino acid related enzymes [BR:
msuf01007
]
Aminotransferase (transaminase)
Class I
KV394_11660
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Aminotran_1_2
DegT_DnrJ_EryC1
Aminotran_5
Beta_elim_lyase
Cys_Met_Meta_PP
Aminotran_3
Motif
Other DBs
NCBI-ProteinID:
UPL11730
UniProt:
A0ABY4IG18
LinkDB
All DBs
Position
2414909..2416135
Genome browser
AA seq
408 aa
AA seq
DB search
MTPSRTFDQSSKLKNVLYEIRGNALVEAARLEAEGHRILKLNTGNPAIFGFDAPHQIVHD
MLAALPTAHGYSDSKGIISARRAVVSRYEQVEGFPRFDPDDVYLGNGVSELITMTMQALL
DEGDEVLIPTPDYPLWTAMTSLAGGTPVHYVCDENDGWQPDLEDLRSKITPRTKAMVIIN
PNNPTGVVYSRAVLEGLVQIAREHQLLILSDEIYDRILFDDAVHIPTATLAPDLLCLTFN
GLSKTYRVAGYRSGWMVITGPQDHAKGFIEGITLLASTRLCPNVPAQHAVQAALSGVQSI
DALIAPTGRLHEQRDIAWEGLEAIPGVTCVKPQGALYAFPRLDPEVHEIRDDAKLVYDLL
VSEHILVVQGTGFNWPNPDHLRLVTLPEPRVLSEAVERLGNFLSSYRQ
NT seq
1227 nt
NT seq
+upstream
nt +downstream
nt
atgacaccatcgcgcaccttcgaccagtcgtcgaagctcaagaacgtcctgtacgagatt
cgcggaaacgccctcgtcgaggcggcgcgactggaggcagagggccaccggatcctcaag
ctgaacacgggcaaccccgcgatcttcggcttcgacgccccgcatcagatcgtgcacgac
atgctggcagccctccccacggcgcacggctacagcgacagcaagggcatcatctccgcg
cgacgcgccgtggtgagccggtacgagcaggtcgagggcttcccgcggttcgaccccgac
gacgtgtacctcggcaacggcgtgtccgagctcatcaccatgaccatgcaggcgctgctc
gacgagggcgacgaggtgctgatcccgacgcccgactatccgctgtggaccgccatgacc
agccttgccggtggcacgccggtgcactacgtgtgcgatgagaacgacggctggcagccc
gatctggaagatctccggtccaagatcacgccgcggaccaaagccatggtcatcatcaac
ccgaacaacccgaccggtgtcgtgtactcgcgcgcggtgctggagggcctggtgcagatc
gccagggagcatcagctgctcatcctgtcggacgagatctacgaccgcatcctgttcgac
gatgcggtgcacatccccacggcgaccctcgcgcccgacctgctgtgcctcacgttcaac
ggcctctcgaagacgtatcgtgtggcgggctaccgctcggggtggatggtgatcacgggg
ccgcaggaccatgcgaagggcttcatcgagggcatcacactgctggcgtcgacccggctg
tgcccgaacgtgcccgcgcagcacgccgtgcaggcggcgctttccggggtgcagtcgatc
gatgcgctgatcgcgccgaccggtcgcctgcacgagcagcgggacatcgcatgggaaggc
ctggaggcgatcccgggggtgacgtgcgtgaagcctcagggagcgctgtacgccttcccg
cgtctcgaccccgaggtgcatgagatccgtgacgacgcgaagctggtgtacgacctgctg
gtgtcggagcacatcctggtcgtgcagggcaccggattcaactggccgaaccccgatcac
ctgcggttggtgaccctgccagagccgcgagtgctgagcgaagccgtcgagcgactgggg
aacttcctctcgagctaccgccagtag
DBGET
integrated database retrieval system