Mesobacillus subterraneus: LC048_16360 Help Entry LC048_16360       CDS       T09285                                  Name (GenBank) 4Fe-4S binding protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism msut  Mesobacillus subterraneus Pathway msut00020   Citrate cycle (TCA cycle) msut00720   Other carbon fixation pathways msut01100   Metabolic pathways msut01110   Biosynthesis of secondary metabolites msut01120   Microbial metabolism in diverse environments msut01200   Carbon metabolism msut01210   2-Oxocarboxylic acid metabolism Module msut_M00011   Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate Brite KEGG Orthology (KO) [BR:msut00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     LC048_16360   09102 Energy metabolism    00720 Other carbon fixation pathways     LC048_16360 Enzymes [BR:msut01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      LC048_16360 SSDB OrthologParalogGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_10 Fer4_2 Fer4_21 Fer4_6 Fer4_16 Fer4_9 Fer4_4 Fer4_13 Fer4_15 LdpA_Fe-S-bd Fer4_8 Fer4_3 Fer4_17 Fer4_18 Fer4_22 DJ-1_PfpI Motif Other DBs NCBI-ProteinID:  WLR54055 LinkDB All DBs Position complement(3150285..3150515) Genome browser AA seq 76 aa AA seqDB search MEQRVVFNEETCKSCKLCVNACPTNVIYLADYLNEKGYRPAVVTDQENCISCGKCAQMCP DSVITVYRPEKVRKSV NT seq 231 nt NT seq  +upstreamnt  +downstreamnt gtggagcagagagttgtttttaatgaagagacttgtaaatcatgcaagctgtgcgtgaac gcttgtccgacaaatgtcatttatcttgctgattacttgaatgaaaaaggctaccggccg gcggttgtgacagaccaggaaaattgcatcagctgtggcaagtgcgcgcaaatgtgtccg gattcggtgatcactgtttataggccagaaaaggtaaggaaatctgtatag

DBGET integrated database retrieval system