Allomeiothermus silvanus: Mesil_1271
Help
Entry
Mesil_1271 CDS
T01246
Name
(GenBank) proton-translocating NADH-quinone oxidoreductase, chain M
KO
K00342
NADH-quinone oxidoreductase subunit M [EC:
7.1.1.2
]
Organism
msv
Allomeiothermus silvanus
Pathway
msv00190
Oxidative phosphorylation
msv01100
Metabolic pathways
Module
msv_M00144
NADH:quinone oxidoreductase, prokaryotes
Brite
KEGG Orthology (KO) [BR:
msv00001
]
09100 Metabolism
09102 Energy metabolism
00190 Oxidative phosphorylation
Mesil_1271
Enzymes [BR:
msv01000
]
7. Translocases
7.1 Catalysing the translocation of protons
7.1.1 Linked to oxidoreductase reactions
7.1.1.2 NADH:ubiquinone reductase (H+-translocating)
Mesil_1271
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Proton_antipo_M
Motif
Other DBs
NCBI-ProteinID:
ADH63166
UniProt:
D7BEC3
LinkDB
All DBs
Position
complement(1253089..1254513)
Genome browser
AA seq
474 aa
AA seq
DB search
MSLADIALFLPLLAGVSLVLWPGLGRPFAWVASGGVFVLSLVMFFLHPKEGIAYLTQTPL
LGPAGIYYAVGLDNAAMFLWLAVSFTVFLSVWVAKAPTRMLGYALMMETGLLGIFAALDL
VLFYVFFEFTLIPALLMLGLYGGRERMRALYTFALFTLVGSLPMLAAILAARFLGGAESF
LIGDLYNHPLKGVAASWVFLGFFFALAVKTPLFPLHAWLPSFHQENHPSGLADAMGTLYK
VGIFAFFRWAMPLAPEGFQGLQPLLLTLAAFTAIYAAWAAWGAKDWKNLLAYGGISHMGL
AAIGLFSGTSEGAVGALFLLGASFVYTGGMFLFTGLLYERTGTLEIGPVRGLAKSAPALA
ALGMILVMSMIGLPGLAGFPGEFMALLGAYKASPWLTFVAFLSVIAAAAYALTAYQKVFH
ESENRAVPDMTLQEWSFAVVIVAAIALLGLYPKLFTQLLQPLAKAFAALFGGAA
NT seq
1425 nt
NT seq
+upstream
nt +downstream
nt
atgagcctggccgatatcgccctcttcctccccctgctggcgggggtatccctggtgcta
tggcctgggctgggccgcccgttcgcctgggtggcctcgggcggggtgtttgtgctgagc
ctggtgatgttcttcctccaccctaaggaggggatcgcctacctcacccaaactccgctg
ctgggccctgctgggatctactacgcagttggcctcgataacgcggccatgttcctctgg
ctggcggtaagcttcacggtcttcctgagcgtctgggtcgccaaagcccccaccaggatg
ctcggctacgccctgatgatggagaccggcctgttgggcatcttcgccgcgctcgacctg
gtgctcttctacgtgttcttcgagttcaccctgatccccgccctcctcatgctggggctg
tacggcgggcgcgagcggatgcgagcgctatacaccttcgcccttttcaccctggtgggg
tcgctgccgatgctggctgctatcctggcggcccgcttcttaggcggggcggagagcttc
ctgatcggggatctgtacaaccacccgctcaagggggtagcggcgagttgggtcttcttg
ggctttttcttcgccctggcggtcaagaccccgctttttccgctacacgcctggctgccc
agcttccaccaggaaaaccaccctagcggcctggccgacgccatgggcacgctatacaag
gtaggcatcttcgccttcttccgttgggccatgcccctagccccggagggcttccaaggc
ctacagccgctattgctcacgctggccgccttcacggcgatctacgcggcctgggcggcc
tggggagccaaagactggaaaaacctgctggcctacggggggatctcgcacatggggctg
gcggccattgggcttttcagcggaaccagcgagggcgcggtgggggctttgttcctgctg
ggcgcctcgttcgtctatacgggtggaatgtttctctttacgggcttgctctacgagcgc
accggcaccctggagattggcccggtgcgggggcttgccaaaagcgcccccgctttggcc
gcgctgggcatgattctggtgatgagcatgatcggtcttccgggactagccggttttcct
ggggaattcatggcgctcttgggcgcctacaaagccagtccttggctgaccttcgtggcc
ttcctctcggtcatcgctgcggcggcttatgcccttaccgcctatcagaaagtcttccac
gagagcgagaaccgcgccgtccccgatatgaccctgcaggaatggagcttcgcggtggtg
atcgtagcagccatcgccctgctgggcctatatcccaagctcttcacccagctcttgcaa
ccgctggctaaggcgtttgctgcgctcttcggaggtgcggcatga
DBGET
integrated database retrieval system