KEGG   Allomeiothermus silvanus: Mesil_1937
Entry
Mesil_1937        CDS       T01246                                 
Name
(GenBank) UvrD/REP helicase
  KO
K03657  ATP-dependent DNA helicase UvrD/PcrA [EC:5.6.2.4]
Organism
msv  Allomeiothermus silvanus
Pathway
msv03420  Nucleotide excision repair
msv03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:msv00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    Mesil_1937
   03430 Mismatch repair
    Mesil_1937
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:msv03400]
    Mesil_1937
Enzymes [BR:msv01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.4  DNA 3'-5' helicase
     Mesil_1937
DNA repair and recombination proteins [BR:msv03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Mesil_1937
   MMR (mismatch excision repair)
    Other MMR factors
     Mesil_1937
SSDB
Motif
Pfam: UvrD-helicase UvrD_C AAA_19 UvrD_C_2 PcrA_UvrD_tudor Viral_helicase1 AAA_30 AAA_11 AAA_12 PhoH ResIII DUF3553 Prolactin_RP
Other DBs
NCBI-ProteinID: ADH63812
UniProt: D7BGJ6
LinkDB
Position
1918894..1921074
AA seq 726 aa
MVDFESSMSDLLSSLNEAQQAAVKHFEGPALVVAGAGSGKTRTVVHRIAYLLREHRVYAG
EILAVTFTNKAAGEMKERLGKMVGRAAHDLWVSTFHSAALRILRVYGEWVGLKPGFVVYD
DDDQNTLLKEILKDLGLEAKPGAVRAVLDRIKNRLGGISEFLRDAPDYVAGILREDAALV
YQRYQQSLRAQGAVDFNDLLLLAIELFENHPEILHKVQQRARFIHVDEYQDTNPVQYRLT
RLLAGENPNLMVVGDPDQSIYGFRNADINNILDFTKDYPGAKVYRLEENYRSTSAILSLA
NAVIAKNALRLEKTLRPVKGGGDPVCLFRAPNAREEAAFVAREIARLGNFGQIAILYRTN
AQSRLLEEHLRRAQIPARLVGAVGFFERREVKDILAYARLAVNPLDSISLRRIVNVPTRG
IGASTVAKLLEHAQQHGIPALEAFRQAEAILSRPQQVGAFVELVDELAEAAFETGPAEFL
ERVLDATDYKTFIKDEPDAEDRLANLEELLRAARDWEAEFGGTLAEFLDTIALTASIEEP
AKRVQDGKLEAPREKAEEVTLMTLHNAKGLEFPIVFLVGVEENLLPHRNSLNRLEDLEEE
RRLFYVGITRAQERLYLSYAEEREIYGKRESTRPSRFLEDIPEGMLTEVNPFGEFGRGVR
PVTVGWAAAPSRPKLAENFKGGEKVKHPRFGNGTVVAALGGEVTVHFPGVGLKKLAVKFA
GLELLE
NT seq 2181 nt   +upstreamnt  +downstreamnt
atggtagacttcgaaagttctatgtcggatctcctttcctctttgaacgaagcccagcaa
gccgcagtcaagcactttgaaggcccggccctggtggtggcgggggctgggtcgggtaag
acccgcactgtggttcatcgcatcgcctaccttttacgtgagcaccgggtctacgctggg
gagatcttggccgtgactttcaccaataaagccgccggggagatgaaagagcgcctcggc
aagatggtgggtagagcggcccatgatctgtgggtttcgaccttccactcggcggccttg
cgcatcttgcgggtgtacggggaatgggtcgggctaaagccggggtttgtggtgtacgac
gacgacgaccagaataccttgctcaaggagatccttaaggatctggggctcgaggctaaa
cctggtgcggtgcgagcggtactggaccggatcaaaaaccggctgggtggaatctccgag
ttcttgcgcgatgcccccgactacgtggccggaatcctgcgcgaggacgctgcgctggtt
taccagcgctaccagcaaagcctgcgggcacagggggcggtagactttaacgacctcctt
ttgttggctattgaactatttgagaaccatcccgaaatattgcacaaggtgcagcagcgg
gcgcgctttatccacgtggacgagtaccaggacaccaaccccgtgcagtacaggctcacc
cggcttctggccggggaaaaccctaacttgatggtcgttggggatcccgaccaaagcatc
tacggctttcgcaatgccgatatcaacaacatcctggacttcaccaaggactaccctggg
gccaaggtctaccgcctcgaggagaactaccgctccaccagcgctattcttagcttggcc
aatgcggtgattgccaagaacgcactgcggcttgagaagaccctgcgcccggtgaaaggc
gggggagacccggtgtgcctttttcgggctcctaacgctcgtgaggaggcagcctttgta
gcgcgggagatcgcccggttaggtaacttcggacaaatcgccatcctctaccgcaccaac
gcccagtcgcggcttttggaagagcacctgcgacgcgcccagatcccggcccggttggta
ggggcggtgggcttcttcgagcggcgggaggtcaaggacatcctggcttacgcccggcta
gcagtaaaccctctggactcgatcagcctacgccggattgtcaacgtgcccactaggggg
attggggccagcacggtggcgaaactgctcgagcacgcccagcagcacggcatacccgct
ctggaggctttccgtcaggccgaggccatcctttccaggccacagcaggtgggggctttc
gtcgagctggtggacgaactggccgaggctgctttcgagactggcccggcagagttcctc
gagcgggtgctggacgccaccgactacaaaaccttcatcaaggacgagcccgatgccgaa
gaccgcctggccaacctcgaagagctgttgcgggcagcccgcgactgggaggccgaattc
ggcggaaccctggccgaattcctcgacaccatcgcccttacagcctctatcgaggaacca
gccaagcgcgtgcaggatggcaagctcgaggctccacgggaaaaggccgaggaagtcacc
ctgatgaccctgcataacgctaaggggctcgagtttcccatcgtcttcctggtcggggtg
gaggaaaatctcctgcctcaccgcaacagcctgaaccggctggaggacttagaagaggag
cgccgcttgttctacgtgggcattacccgtgcccaggagcggctgtacctctcctacgct
gaggagcgcgagatctacggcaagcgtgagtctacccgccccagccgcttcctcgaggac
atcccggaggggatgctcaccgaggtcaaccccttcggggagttcgggcgcggggtcagg
ccggtcacggtgggctgggcagctgcgccctcccgccctaagctcgcggagaacttcaaa
ggcggcgagaaggtcaagcacccccgtttcggcaacgggacggtggtagcggccttggga
ggcgaggtgacggtgcacttccccggcgtgggactcaaaaagttggcggtgaagtttgcc
gggctcgagcttctcgagtga

DBGET integrated database retrieval system