Allomeiothermus silvanus: Mesil_3335 Help Entry Mesil_3335        CDS       T01246                                  Name (GenBank) hypothetical protein   KO K03116   sec-independent protein translocase protein TatA Organism msv  Allomeiothermus silvanus Pathway msv03060   Protein export msv03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:msv00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     Mesil_3335  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     Mesil_3335  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:msv02044]     Mesil_3335 Secretion system [BR:msv02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    Mesil_3335 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E Motif Other DBs NCBI-ProteinID:  ADH65149 UniProt:  D7BIZ3 LinkDB All DBs Position pMESIL01:complement(130530..130736) Genome browser AA seq 68 aa AA seqDB search MLAGQDLVVVLLIALLLLGPKQLPGLARGLGQSVREFKKGAEGLLDEDKPVAPEPPKPAA TEQDKAKP NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atgctggccggtcaagatctggtagtggtacttctcattgccctgctgctgctcgggccc aagcagcttcccgggctcgctcgagggttgggtcagagtgtgcgggagttcaagaagggc gctgaggggctcttggacgaggataaacccgtagccccggagccgcctaaacccgcagcc accgagcaagacaaggcaaaaccctag

DBGET integrated database retrieval system