Methanosarcina siciliae T4/M: MSSIT_1567 Help Entry MSSIT_1567        CDS       T03865                                  Name (GenBank) NADH dehydrogenase subunit J   KO K22165   F420H2 dehydrogenase subunit J [EC:1.5.98.3] Organism msw  Methanosarcina siciliae T4/M Brite KEGG Orthology (KO) [BR:msw00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     MSSIT_1567 Enzymes [BR:msw01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.98  With other, known, physiological acceptors     1.5.98.3  coenzyme F420:methanophenazine dehydrogenase      MSSIT_1567 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Oxidored_q3 MASE6 MbhD Motif Other DBs NCBI-ProteinID:  AKB28286 UniProt:  A0A0E3L8C6 LinkDB All DBs Position 1948392..1948682 Genome browser AA seq 96 aa AA seqDB search MIGLETVGAALEMAVFGLLALVTVFFAIFVVIAKDVVRAGLALIMCMFGVAVLYILLNAQ FLGIIQVLVYIGAIGVLILFAVMLTKRELGGGSRAN NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgatcggacttgaaacggttggagcagctctggaaatggctgtcttcggactccttgca cttgtcacggtcttctttgcaatttttgtggttattgcaaaagatgtcgttagagccggg cttgccctgattatgtgcatgttcggtgttgcagtactttacattctcttaaacgctcag ttccttggaataattcaggtgctggtctatataggagcaatcggagtgctgatcctcttt gcggttatgcttacaaaacgcgaactcggaggtgggtctcgtgcgaattaa

DBGET integrated database retrieval system