Methanosarcina siciliae T4/M: MSSIT_3103 Help Entry MSSIT_3103        CDS       T03865                                  Name (GenBank) SSU ribosomal protein S27Ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism msw  Methanosarcina siciliae T4/M Pathway msw03010   Ribosome Brite KEGG Orthology (KO) [BR:msw00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     MSSIT_3103   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     MSSIT_3103  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:msw03011]     MSSIT_3103    04121 Ubiquitin system [BR:msw04121]     MSSIT_3103   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:msw04147]     MSSIT_3103 Ribosome [BR:msw03011]  Ribosomal proteins   Eukaryotes    Small subunit     MSSIT_3103   Archaea     MSSIT_3103 Ubiquitin system [BR:msw04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    MSSIT_3103 Exosome [BR:msw04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    MSSIT_3103   Exosomal proteins of colorectal cancer cells    MSSIT_3103 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Zn_ribbon_Nudix Ribosomal_L37e Rcat_RNF216 IBR_1 Zn_ribbon_RPB9 IBR Zn_Ribbon_TF Zn_ribbon_3 Cas12f1-like_TNB DUF6671 DUF1451 Zn_ribbon_11 MqsA_antitoxin Zn_ribbon_IS1595 Zn_ribbon_NOB1 Motif Other DBs NCBI-ProteinID:  AKB29822 UniProt:  A0A0E3P9N5 LinkDB All DBs Position 3909172..3909321 Genome browser AA seq 49 aa AA seqDB search MAVKDYYKVQGDSVTRLKQFCPRCGPGIFLADHKNRLACGKCGYTEFKK NT seq 150 nt NT seq  +upstreamnt  +downstreamnt atggcagtaaaagattactacaaagttcagggcgactccgtaaccagactcaaacaattc tgtcccagatgcggacccggcatattccttgccgaccacaaaaaccgccttgcctgcgga aagtgcggctacaccgaattcaagaaataa

DBGET integrated database retrieval system