Malus sylvestris (European crab apple): 126600549 Help Entry 126600549         CDS       T09027                                  Name (RefSeq) protein MHF1 homolog   KO K11511   centromere protein S Organism msyl  Malus sylvestris (European crab apple) Pathway msyl03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:msyl00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     126600549  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:msyl03036]     126600549    03400 DNA repair and recombination proteins [BR:msyl03400]     126600549 Chromosome and associated proteins [BR:msyl03036]  Eukaryotic type   Centromeric chromatin formation proteins    Kinetochore proteins     Centromere proteins      126600549 DNA repair and recombination proteins [BR:msyl03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      126600549 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-S CENP-T_C TFIID-31kDa Bromo_TP RBP_receptor UCH_UBL1 Antigen_Bd37 Histone Motif Other DBs NCBI-GeneID:  126600549 NCBI-ProteinID:  XP_050123088 LinkDB All DBs Position 14:complement(22038574..22040492) Genome browser AA seq 128 aa AA seqDB search MEREEDDSESELLIDRFRLSTIHIAEAEAKRNAMEISGPVMACIADLAFKYTEQLAKDLE LFSQHGGRKTANMEDVILSAHRNEHLAALLRSFCNDLKAKEPQSERNRKKSSKREDQATT SVVHIPDS NT seq 387 nt NT seq  +upstreamnt  +downstreamnt atggagagggaggaagacgactcagagagcgagcttctcatagatcgattcagactctcg accatccacatagccgaagccgaagcgaagcgaaacgccatggagatttcgggccccgtg atggcttgcattgccgatttggctttcaagtatacagaacagttggcaaaggacctcgag ttattttctcaacacggtggtcgtaaaactgcaaacatggaagacgtcatactttctgca cacagaaacgaacatctggccgccttgttgaggtccttctgcaacgatctgaaagccaaa gaaccacaatctgagaggaacagaaagaaatcatcaaagagggaagaccaagcaactacc agtgtagtacatattccagattcttag

DBGET integrated database retrieval system